CAZyme Information: MGYG000002121_00738

Basic Information

• Species: Acidaminococcus sp000437815
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp000437815
• CAZyme ID: MGYG000002121_00738
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000002121_10|CGC1	39578.89	7.6214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002121	1985893	MAG	Mongolia	Asia

• Gene Location: Start: 1125; End: 2192 Strand: -

Full Sequence      

MTYKNIFVDGIMHMGDMIMTASVFPVLRKHCPGARITYLCSANLAFVAELLEGVDEVIPY
RYASGGGYGDVWRMGRQLSQRHFDLGISLDPRERVTLMKWFARIPERISMEQALGWKLGW
EKWFYTRDLELPAGWSYQEHSMAASFQQMMRGFFGDPSQEFVPPRLKPMAAEQERWAQKL
LQKAPAAGKKIALCIQTTSRTKDWPAEKFSQVCDWLAETYGATLYLTGIPAHRERGNAIL
QEMKHREAVVDLIGKTSFLELTALLAHMDLLLTLDTGTAHIGAAAGCPVVTLFTFNSPVI
YRAPGKHCVGVSGHLPCSGKHICIGPSRCTKSDCVDAVTVPMAEAAIETLFQETA

Enzyme Prediction     

No EC number prediction in MGYG000002121_00738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	321	4.4e-42	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.12e-51	4	338	2	322	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.14e-51	13	348	9	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.06e-32	71	318	1	234	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	9.43e-20	5	298	1	282	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	5.29e-18	15	293	17	288	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB82130.1	1.47e-150	1	352	1	352
AEQ21322.1	3.19e-142	4	352	13	361
AOH48991.1	5.65e-46	13	317	3	301
BBB91611.1	2.19e-38	3	353	9	352
AMV36959.1	4.34e-26	14	339	24	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.17e-16	3	309	8	303	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	9.73e-11	5	298	2	292	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	1.75e-10	5	298	2	292	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
Q57336	5.61e-10	4	299	9	287	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	1.02e-07	15	302	5	285	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002121_00738.