CAZyme Information: MGYG000002125_00201

Basic Information

• Species: UMGS1795 sp900555125
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900555125
• CAZyme ID: MGYG000002125_00201
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		59367.94	6.3508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002125	1699850	MAG	Mongolia	Asia

• Gene Location: Start: 94437; End: 96014 Strand: -

Full Sequence      

MSDIVFGIKTRIGILIGANAENEDFQREAFRSASAYKLLSCIDVNFDSGLSVLAKWLPYQ
VYCSRFYGRAGYYQISGAYGFRDQLQDCLTMLYIDCAAVKKHIIRCAEHQFADGDVMHWW
HEPFFGVRTRIMDDRLFLPYIVSEYISFTGDCFILAERIPFLKNVIIPKGEESVCCAMEP
EKNSESLLEHCKRAIVSVCEEIAPDGLVYMHGGDWNDGMNLVGAGGKGRSVWLSMFLYEV
IGKFARYITLPSEKKYYFEKKSLLKAGVEACFNGKYFIRAIADDGTILGNEKSAECKMDL
LTQAYAAISGITTAEKALSAIECAEKVLVDEKNGIIKLLDPPFEHSEKVGYIGDYPHGVR
ENGGQYTHAAVWFVYALYELGQTEKAFKYLTMLNPVEHYRKYNGDIYGAEPYVMSADVYS
GKNTGKAGWSWYTGSASWMYVTIIKKLFGIEIKNGVVSFSPNLPTEVKRAFVTVRYEGKT
LNVNIDNGDEGEQWRIVYGEVEYNTNTLDLKNLKNDKTITLKRSR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	51	518	5.7e-155	0.444980694980695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	8.51e-118	56	490	588	1022	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	6.18e-84	56	451	25	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDB99444.1	1.75e-108	13	466	2331	2793
AWI56298.1	6.44e-106	38	487	177	635
BAV52290.1	1.10e-105	23	485	2355	2828
BCG74039.1	1.10e-105	23	485	2355	2828
ARO87638.1	1.10e-105	3	493	2343	2856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	6.95e-33	56	487	331	772	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	7.56e-32	18	487	319	805	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	1.01e-31	18	487	319	805	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3S4C_A	2.37e-31	75	497	360	796	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3ACT_A	5.84e-31	18	487	319	805	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	2.32e-87	52	485	2364	2805	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	2.12e-32	9	487	282	774	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	9.86e-29	55	492	334	760	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q8P3J4	7.59e-22	47	483	331	756	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1
Q92AT0	9.25e-12	50	500	578	1046	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000041	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002125_00201.