CAZyme Information: MGYG000002125_00250

Basic Information

• Species: UMGS1795 sp900555125
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900555125
• CAZyme ID: MGYG000002125_00250
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	MGYG000002125_3|CGC2	94281.89	5.4582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002125	1699850	MAG	Mongolia	Asia

• Gene Location: Start: 74367; End: 76904 Strand: -

Full Sequence      

MKYKGKNLREIKFPLGGIGTGCVNICGNGRMCDFEIFDRPDKGGLNGYTHFAVKAQTGGK
KFVKVLQGDYDGSFMGEYRRIPYAGYGFGPPAETMAGFPHFKKVTFDGKFPIAELKFSDA
EFPGKITLTAFNPLIPYDSYNSGLPAAFFEIEYENDTDDAIEFTSAFSVRNPFGASLNES
ISGRYQGAGLINAAANDIDAPDYGNLSVMTDCENACVQKYWYRGGWQDGIVTFFREFSEK
ESLSDREYEAPGKNDCCSVCGTIIAGPHEKKTIKFVLSWYSPNRGNYWEDVRDATGKYIT
WKNYYATLFSSSEEVAKYCLENFGALKEKTEKFVRSVAHSSLCTVFKDAALSNLAVLHSP
VVMRLEGGEFYGWEGSLEQAGSCEGSCQHVWNYACALCFLFPDLERSMRDLEIKYCLRSD
GGTAFRLKLPLDRNPGDFRSCVDGHMGTIAKIYREWKLSGDDEWLKGKWSAVKKMLDFAT
SPENADLWDEKGEGVIVGRQHHTLDMELFGANSWLQGFYLLALKAGAGIADYLGDRAAFT
KYTALFEKGRKFLNEKLFNGEYFVQKINLKDKSITDKFGCSDVYYNDEAGEIKYQIGEGC
EIDQLCAQWHAALTGIGEIFETEKAKTALCSMLKYNYKPSMRSFVNPWRVFALNDEAGTV
MCEYPTGSVKPAVPLPYCEECMTGFEYEFAALLSLYGMTEESEKIVRSVRNRYDGSNRNP
FGEIECGSDYARSMASWSLIPVSSGFYFDIPHKTIGFNPVQDGEFCCPWSAGGAYGLFER
KTNGDVKIKIIFGKISLEKIKLPFVKTVKSLAIDGKKTGFVFGEGTLGFAATDIERGITI
KTTGA

Enzyme Prediction     

No EC number prediction in MGYG000002125_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	369	739	3.2e-59	0.9917355371900827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4354	COG4354	1.75e-47	1	746	3	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam12215	Glyco_hydr_116N	8.81e-45	13	323	2	306	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	3.02e-43	390	739	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98507.1	5.00e-284	2	833	5	854
QUH30377.1	4.79e-276	3	832	4	851
QGQ98288.1	1.84e-275	3	814	5	842
BBH18759.1	3.67e-268	3	803	5	820
AZN43107.1	6.88e-268	2	802	4	818

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZF3	2.42e-10	14	735	144	867	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q5M868	9.44e-10	14	735	144	867	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	4.89e-09	14	735	153	876	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	1.30e-07	103	739	220	936	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002125_00250.