CAZyme Information: MGYG000002125_00542

Basic Information

• Species: UMGS1795 sp900555125
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900555125
• CAZyme ID: MGYG000002125_00542
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		41248.89	6.3556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002125	1699850	MAG	Mongolia	Asia

• Gene Location: Start: 23323; End: 24438 Strand: -

Full Sequence      

MLGKIICDLAPKKNNPRNSEGAFIELKSGRIMFAYTHYLGDDGDDGAPAEIRAFYLSSDG
ETVGKEHKIEGLVPDNVDFQNLMSVSLVRTRSGRIAMIYLVKHRSYNCTPYIVFSDDEGA
SWSCPKRIIEENGYFVLNNDRVITLKDGRLLLAVAHTPFELSPEADGTTWKKGVKGLPAD
VWVYASSDEGDSWSKISEVPYIYSARQYFTCGWQEPGLIQLNDGTVRMLIRTELGRIYDC
FSSDGGKSWTTPAPCEFTAPISPICMKRLSSGKTVYVWNPVPLYNGKSQDVDGVWTGARN
PLAITALSDGERLRKISEVDRDEKRGFAYTAIHELGSGSLLLGYCAGGVEDKGMLNRLRI
RKISKNEVELL

Enzyme Prediction     

No EC number prediction in MGYG000002125_00542.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	24	344	1.9e-22	0.8713450292397661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	5.66e-27	43	353	39	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.53e-18	87	332	56	270	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	3.14e-07	21	226	148	318	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.003	19	153	200	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam15902	Sortilin-Vps10	0.005	183	263	3	66	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46468.1	8.45e-66	6	363	10	354
AHF14608.1	4.56e-65	5	363	46	380
QEC54313.1	1.98e-64	4	369	36	373
AKP51796.1	4.04e-64	4	347	35	355
AEL26177.1	8.00e-62	4	347	28	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002125_00542.