CAZyme Information: MGYG000002126_01785

Basic Information

• Species: UBA1390 sp900764045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp900764045
• CAZyme ID: MGYG000002126_01785
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	MGYG000002126_42|CGC1	90058.35	5.5228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002126	2317686	MAG	Mongolia	Asia

• Gene Location: Start: 7378; End: 9741 Strand: +

Full Sequence      

MNDVLMSKAPAAWYRDLWREAYPSGNGQIAMLSYGHVAEETVIINHSALWHHSHKMEVPQ
LHGALQRTREQMDAGDLWNANWIITNELKEKGFSASLGAPFPVCALHFTNHKAGSFSQYR
RRLHMDRAEICMQWQDGGYSLSRQGFVSRVDDMVVWKLYSEAEQDQTISLALHETGEEDT
QRKKEELGESLKIYAKPPYIYYAGTNDDGLDFGAVARVITDGRFTEQEGALRIQGGHEAL
VLVKVFVRSLDRRQDFTRLTRELEAVEAPYEELLERHRPLHEALYRSAELELAEEPELDG
ASNEELLERAYDGGAPNALLNKLWKYGRYLMICGTRPGALPFPLYGIYHGRYSMAWPHNM
ANENTQMIYWHVLGGGLGSLYEALIDYYLSNMEQYRDNARKLFELPGIYMPAGSTPGNAV
PNQIVPVIMNWIGCAGWIAQHFYSYYQYTGDETLLREKILPFMKEAADFYEAYLVRREDG
SYVIYPSVSPENTPKSLMPSEEWEHMAHPCPSAYNATMDIAIIKELLTNLCEAAGKTGMY
ADKTEKWQEIIDNLPKYEATEDGDMREWQWPGLTQRYNHRHLSHIYPMFPGREIVKGVAP
KELTDQFELAVDKRLLGAQTGWSLAHMACINARFERPQKALECLDIMCRACLTKSFFTLH
NDWRNMGQTLYRDNGAFAPVQLDASMGVVGAMQEMLLFVQPECVKLLPALPERWNQGKAR
LRYMQGEVEMTWDKQAGTLCVEFRPDRAAEVKVLLPEEWAAGLRYEDGTSFVNGSVLKLD
HVVRMQR

Enzyme Prediction     

No EC number prediction in MGYG000002126_01785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	8	736	1.3e-155	0.945983379501385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	2.28e-24	5	243	1	225	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
COG1554	ATH1	2.10e-06	384	554	375	548	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	3.86e-06	383	578	56	262	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF27939.1	3.19e-241	2	756	8	757
QKS45791.1	2.84e-240	5	756	11	758
QGH32985.1	2.90e-231	2	756	8	758
AYB47098.1	2.94e-227	2	756	4	785
QZN78893.1	1.83e-225	2	762	5	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	1.23e-45	1	733	32	738	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
4UFC_A	5.29e-41	18	732	33	721	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	9.07e-41	18	736	14	736	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAD_A	1.46e-26	18	777	47	873	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]
2EAB_A	1.93e-26	18	777	47	873	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	3.58e-47	18	743	63	800	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	9.59e-32	14	733	31	757	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002126_01785.