CAZyme Information: MGYG000002128_00261

Basic Information

• Species: UBA5905 sp900764115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp900764115
• CAZyme ID: MGYG000002128_00261
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	MGYG000002128_20|CGC1	46468.93	8.6229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002128	1836309	MAG	Mongolia	Asia

• Gene Location: Start: 8429; End: 9688 Strand: -

Full Sequence      

MIYLIADQFHRCFGVLFFLLYAYQFFYLIVPLLFRRKAAPPPAAPRRMAVLVAARNEAAV
IGQLLDSINAQTYPADKRAVFVVADNCTDDTAAVSAAHGATVFERHNTRQVGKGYALDYL
LHAMAAGETDFDAYLVLDADNLLSPDYLEQMNRTLAQGYPIVTGYRASKNYGDNWISAGY
GLWFLRESQQLNRPRHRLGTGCFVSGTGFAFTAEILRRQGGGWPYHLLTEDLEFTAVHLA
AGDSIGYCEGAILYDEQPTRFSQSWRQRMRWAKGFLQVLRQEGNSLLAGIRRGSFACFDM
IASMFPAVALTVGGLLVCGAEIAALLIAVVSSLPALMSLARMAAGVGGTLYLLGGVTLLT
EWKRIPAPGWKKLLYYLLFPLFMLTYVPIAVAALFRPVEWRPVAHTRALTLRELVPEKE

Enzyme Prediction     

No EC number prediction in MGYG000002128_00261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	272	2.5e-32	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	9.90e-84	50	234	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	2.16e-32	50	231	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.91e-31	13	406	12	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	2.03e-28	49	274	5	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	5.35e-18	49	278	32	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS20330.1	3.25e-123	51	414	48	410
QUO33965.1	3.45e-119	51	416	48	419
BCI61275.1	5.38e-119	51	414	51	422
AUO18464.1	1.90e-118	9	414	7	413
BCK81367.1	4.61e-118	51	416	53	424

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	3.07e-11	51	277	113	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	5.18e-10	51	304	111	362	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	2.15e-09	51	304	111	362	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34
307	329
336	358
373	395