CAZyme Information: MGYG000002131_00078

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_00078
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000002131_2|CGC1	45250.11	8.9055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 18428; End: 19621 Strand: -

Full Sequence      

MSFIMTITILFLIMYLPRVVGWFAWLKPQKALKSDKLRRFALIVPARDEGRAVLPLFSSI
RGQSYPEELFDIYVVVKNPKDEVIGYAKDIGAHVHVDEEQKSKGDCLDYCIRHILAAGRK
YDGYIIVDADCRLDADFIKNMNDAMESGAQVITGRKLAGNYTCGKAGAVNAVTCLNGLIW
SIIDELGNRYKSAAGLTTMPITTGILIRGDLIAEWGGWNYRQTLTEDMELLRDCACKGIK
TFHYSHARLYLEEAPSHADTNRRRTRWMTGMVSADKIYLRELLRRRGLWAFIDNYYILSL
WIVYVYIGTLSAAVVYFLFTLRFIEALAAFLLIYTAFLALSVMAVLADWSNIGLSWVKKL
CLMLVHPFFYMEYICIVGRAVLGIKPKSWEKIGRVQY

Enzyme Prediction     

No EC number prediction in MGYG000002131_00078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	125	323	6e-17	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.04e-33	43	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	2.45e-18	42	227	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.49e-17	2	396	18	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	9.59e-12	38	270	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	4.59e-09	125	332	3	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE15924.1	1.85e-125	7	396	10	414
QNL97367.1	8.75e-47	7	396	16	441
AMJ39935.1	1.14e-32	20	285	25	282
QIA32313.1	2.80e-32	7	392	14	413
ANU40170.1	2.80e-32	7	392	14	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996328	0.003637	0.000029	0.000015	0.000009	0.000023

TMHMM  Annotations     

start	end
4	26
166	183
297	319
326	347
362	384