CAZyme Information: MGYG000002131_00486

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_00486
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002131_17|CGC1	42135.01	5.1856

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 372; End: 1475 Strand: -

Full Sequence      

MNISEAAEKYNPEKYARACCDTMMRKFEAAKLPPEGRFHYHQGVFLSGMYRAYVLTGDEK
YYDYIKAWVDSTIDEKGSIKLYDKGQMDDIEPGVLLFPIYERTGDIRYKRALDTLISDME
SYPHNEDGGYWHKAWCEGEMWLDGLYMGGPITAHYGSAFEKPEWFDMVAKQIKLMKQHTE
DKKTGLWKHAWDINKKAVWADTVTGQSPEFWGRSLGWVPMAILDDLRYIPEYHKDYDELV
SIMKELLINICRYQSEEGRWYQVVDKGGEKGNWLENSCSCLFVAAICRAVKKGFLPESYL
DVAAKGYAAVNDSLTWRGDDLIIGNICIGTGVGNYDFYCARPTCENDLHGSGAYLLMCAA
VMDVMRR

Enzyme Prediction     

No EC number prediction in MGYG000002131_00486.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	33	362	1.7e-100	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.19e-106	11	356	7	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.74e-102	15	356	1	334	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	2.47e-151	14	365	7	359
ATO42094.1	1.23e-144	11	364	5	359
AFU70692.1	1.23e-144	11	364	5	359
QYN59722.1	1.16e-140	12	361	8	358
AFH61356.1	6.43e-139	3	358	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	4.00e-107	11	366	12	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.65e-106	11	366	2	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	5.91e-69	13	356	2	353	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3PMM_A	2.18e-21	38	342	66	359	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	5.47e-21	38	338	65	354	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.19e-106	11	366	12	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.82e-23	147	366	1	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.82e-23	147	366	1	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002131_00486.