CAZyme Information: MGYG000002131_01153

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_01153
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000002131_59|CGC1	94433.4	6.8069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 2683; End: 5172 Strand: -

Full Sequence      

MDKFIFVYDKRIDLRDSNRLIIRAGSCRKYMKDVKAVSYVNGIETEVEIVENPHTPLLFV
YKNAEPEFDGEYNLCVRLPKNVKNVKIILKKDTYPSGVEEINIPSSQLEYLKAHIGINLI
GVQADEKNKNIKVTGWAESAGKPKLRVFAGSRELEVKENSFTRPDMVSRYLDGELNESCG
FELTVEDNGARAIKITSEENGRRGSVRVVVNRPSSEKEKHSVRLAEDKRNDYIARARRYI
AMYGMKRFVEKATLKMARKLTGRDIKDATNEYYKKINPDEARLAEQRSYKFAEKYKFSIL
IPVYRPDIKFFTLMLDSIAAQTYGNWQVCLADGGGEGYTVEDTVKPYIEKYGTDKVKYVK
LENNLGIAENTNAAMRMADGDFIVFGDHDDELHPTALFECMRELERYPQADFIYTDEDKI
IEATGRHTEAHFKSDLNMELLRCNNYICHLSVVKKSLADKVGGLDTRYNGSQDHDYILRC
VEKAECVRHIPRILYHWRINDNSTAKSASTKTYANTAGVEAVAAHLNRIGIEGEVRNGIA
PGFYDIRYKLNAEPLISVIIPNKDHLDDLTRCLDSMENINNYRNVEYIVVENNSVLDETF
EGYKELEKKYGDRFKLVKWGGIFNYSAINNFGARYAKGKYILLLNNDTSVIEPDSIRCML
AQCQRAEVGIVGAKLLYDDDTVQHAGVILGYQGVAGHAFVGIGDKVYGYFARAVLSQELS
AVTAACLLTKRTVFDEVGGLDESFEVAFNDIDYCMKVRAAGYKIIYEPHAKLHHYEYKSR
GAEDTGKKQERFGGEIMHFIDKWRDALIAGDMYYNPNLELVGELYTIKK

Enzyme Prediction     

No EC number prediction in MGYG000002131_01153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	298	414	7.7e-19	0.6647058823529411
GT2	557	738	1.5e-16	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.15e-83	296	499	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.34e-42	558	776	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	1.73e-26	298	504	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.56e-26	553	781	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.20e-16	298	408	1	107	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO33456.1	1.47e-207	67	828	66	811
QHB25117.1	6.30e-204	1	820	1	805
QRT31219.1	6.30e-204	1	820	1	805
QEI32629.1	6.30e-204	1	820	1	805
CBL21587.1	1.84e-203	1	829	1	814

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.36e-119	298	820	369	890	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.42e-77	278	820	302	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P39614	9.83e-08	296	508	2	209	Uncharacterized glycosyltransferase YwdF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywdF PE=3 SV=1
A1KMV1	2.81e-07	297	487	6	188	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2978 PE=3 SV=2
A5U6W5	2.81e-07	297	487	6	188	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2984 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=MRA_2984 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002131_01153.