CAZyme Information: MGYG000002131_01282

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_01282
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496		54827.07	8.0995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 10993; End: 12483 Strand: -

Full Sequence      

MNVNRNYITKINFTDKNSTARIKYIVIHYFGSLCSVLALGKYWASQYAGASAHYGIGHDG
EIFQFVEDDDVAWHCGAKSYKHGDCRNTNSIGIEMAVKKRNTATLSAADKDWYFTDETIK
SAIELTRSLMKKYNIPAENVIRHYDVTGKICPNPYVYNVMEETWQKFKAAIAAEDETEGF
TKIMGAADATAEQIAAYMIEKNPNTASFAAELAQLYIEEGSAEGVRGDVAAAQSMLETGN
FTFAGSAVTLDQNNFCGMGVTANGMKGNSFASKREGVRAQIQHLKAYASEAALVNGCVDP
RFKYVTRGCAEYVEWLGQKENPDGKGWATGKGYGAKILDILAKILKQDEKKEAKPEEVTA
ISGTLKIIYKGSDGVNYRSVPDYNAKAAGVVKYGEVFTVVGEIGDFYKLKSGWYITKRSD
LVAFTKKEQKRYAKIIYKGSDGVNYRSVPDYNAKAAGVVKYGEVFTIVGEEGDFYKLKSG
YYLTKRSDLVEVIHTL

Enzyme Prediction     

No EC number prediction in MGYG000002131_01282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	213	343	1.4e-18	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01510	Amidase_2	7.49e-34	21	154	1	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	1.77e-26	21	155	1	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
COG3023	AmpD	9.37e-21	5	155	21	167	N-acetyl-anhydromuramyl-L-alanine amidase AmpD [Cell wall/membrane/envelope biogenesis].
smart00644	Ami_2	9.45e-19	20	152	1	126	Ami_2 domain.
COG5632	CwlA	1.18e-12	6	175	7	169	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80001.1	3.54e-100	1	470	1	470
QIB57222.1	3.54e-100	1	470	1	470
AFC63685.1	2.01e-80	43	344	44	366
ADL53623.1	9.70e-78	25	358	25	373
QUO23193.1	9.12e-70	184	358	1	174

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1J3G_A	7.97e-09	51	178	73	185	ChainA, AmpD protein [Citrobacter freundii],2Y2B_A crystal structure of AmpD in complex with reaction products [Citrobacter freundii],2Y2B_B crystal structure of AmpD in complex with reaction products [Citrobacter freundii],2Y2B_C crystal structure of AmpD in complex with reaction products [Citrobacter freundii],2Y2C_A crystal structure of AmpD Apoenzyme [Citrobacter freundii],2Y2C_B crystal structure of AmpD Apoenzyme [Citrobacter freundii],2Y2C_C crystal structure of AmpD Apoenzyme [Citrobacter freundii],2Y2D_A crystal structure of AmpD holoenzyme [Citrobacter freundii],2Y2D_B crystal structure of AmpD holoenzyme [Citrobacter freundii],2Y2D_C crystal structure of AmpD holoenzyme [Citrobacter freundii],2Y2E_A crystal structure of AmpD grown at pH 5.5 [Citrobacter freundii],2Y2E_B crystal structure of AmpD grown at pH 5.5 [Citrobacter freundii],2Y2E_C crystal structure of AmpD grown at pH 5.5 [Citrobacter freundii]
2Y28_A	1.46e-08	51	178	73	185	crystalstructure of Se-Met AmpD derivative [Citrobacter freundii],2Y28_B crystal structure of Se-Met AmpD derivative [Citrobacter freundii],2Y28_C crystal structure of Se-Met AmpD derivative [Citrobacter freundii]
2BH7_A	3.66e-08	21	154	28	162	Crystalstructure of a SeMet derivative of AmiD at 2.2 angstroms [Escherichia coli K-12]
2WKX_A	3.66e-08	21	154	28	162	Crystalstructure of the native E. coli zinc amidase AmiD [Escherichia coli K-12],3D2Y_A Complex of the N-acetylmuramyl-L-alanine amidase AmiD from E.coli with the substrate anhydro-N-acetylmuramic acid-L-Ala-D-gamma-Glu-L-Lys [Escherichia coli str. K-12 substr. MG1655],3D2Z_A Complex of the N-acetylmuramyl-L-alanine amidase AmiD from E.coli with the product L-Ala-D-gamma-Glu-L-Lys [Escherichia coli str. K-12 substr. MG1655]
2L47_A	1.79e-06	19	153	20	139	Solutionstructure of the PlyG catalytic domain [Bacillus phage Gamma]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	5.22e-24	192	346	50	197	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
P36550	2.12e-11	20	156	22	156	N-acetylmuramoyl-L-alanine amidase CwlL OS=Bacillus licheniformis OX=1402 GN=cwlL PE=3 SV=1
Q99125	3.64e-11	50	156	57	155	Probable N-acetylmuramoyl-L-alanine amidase OS=Bacillus licheniformis OX=1402 PE=3 SV=1
P0CL03	1.54e-09	51	178	73	185	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=ampD PE=3 SV=1
E1W818	7.05e-09	51	178	73	185	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=ampD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997007	0.002533	0.000045	0.000017	0.000010	0.000406

TMHMM  Annotations     

start	end
25	47