CAZyme Information: MGYG000002131_02096

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_02096
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909	MGYG000002131_177|CGC1	101859.22	4.7295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 17; End: 2746 Strand: +

Full Sequence      

MTDAKNQLDIVVDGTSLTIDVNEKRAIDSEDILPHNEAFMPRVEGMGNLGVRQDGGKCVL
NDFAVYELTADKDVRGGFKQNCFKRYNELIVDNDFYVFNPAGALYLRKKIDIGVNVVKAR
LYATALGFYRVYINDEDACISDYNPGFTDYRKRLMYQTFDVTRLLGGGMNAVGAVVAKGY
YTGYVGYTPNPMVYGRKNAFLARLVIDYEDGTQETIVTDESWEFSDEGPVISSDYQQGEY
RDRRRDFDWVAERELFGKCAVIDVPTRVVPTNGELPSSERLLISAQEGGEPYIDSIINAK
PGYVENPKGHFVFDLGQNIVGRPGLRIRGRGRRGLSIKLRHGEMCYPDGRLYVANMRSAA
NTDCYTLAGYTTEMFSPVGSCHGFRYIEISGNGCELTKKDIDEVFEWVDGYVMSNTSEVA
GGFSCSNEDVNKLQQNIFWGQLGNSLLVYTDCPQRNERMGWTGDAQVFVATAAYNLDIKT
FMEKWLTDLRDAQLMYNRDGAVPDTAPLGGDNRPMGGCAGWGDAAVIVPWKLYIATGDIG
ILEKNYDMMRKWVEYQSRDYRQFNGVRTVDGVKMPECSDISSENYIQIQQSRGDHLTFDA
STPFILTATAYAAYVAGLLARTAELLGKTDDAKRYTERYENVKRAFNEAWVCEDGSLAYW
GEMSKSEPDSFGNIINRTRYAEGEDATKRPSQTAYALALDFDLIPEDKRRRTGECLVRAV
KDRDNKLSVGFLGIEHLVPALCKAGDYDTAYKLLEQTGYPGWLYSVRNGATTIWERWNSY
VAETGTFGDVSMNSFNHYAYGAIGEWLYDSVAGIRTSEEKGCTGYKEIILAPHIGGTLTH
AEGWHETAYGRISSSWSIEDGKTVYKCEVPPNTTAKLYLPWYNMPLGNLPESSQKAIVLG
SGSYEFVEE

Enzyme Prediction     

No EC number prediction in MGYG000002131_02096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	305	879	2.2e-156	0.9940476190476191
CBM67	99	249	2.5e-23	0.7954545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.42e-112	420	811	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.58e-39	116	249	3	137	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.37e-19	813	880	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.59e-17	307	414	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT43572.1	1.91e-173	48	906	258	1046
QYJ14957.1	5.09e-171	106	906	271	999
QGY42517.1	1.13e-170	103	906	163	906
QIN81509.1	5.32e-167	101	907	153	902
CCW35855.1	3.81e-165	105	880	138	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	9.54e-154	115	880	315	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.48e-110	104	880	132	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	5.89e-109	92	909	154	942	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.79e-153	115	880	315	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	5.69e-143	105	883	176	882	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.72e-115	105	880	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002131_02096.