CAZyme Information: MGYG000002132_00133

Basic Information

• Species: Monoglobus sp900542675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900542675
• CAZyme ID: MGYG000002132_00133
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002132_2|CGC3	38315.61	4.5591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002132	1988610	MAG	United States	North America

• Gene Location: Start: 52197; End: 53270 Strand: +

Full Sequence      

MVKQLKKVLCLVLIISVYAASLGGIGILSAYAYSDTSGHWAQSVINKWTASGIISGDGDG
TFRPDDYITRAEFVKVITSAKKYSDVGSVNYFDVSQDDWFYLSLAKAAFAGIISGYEDGT
FRPNDNITREEAAVIIGRAYEISAASAARFSDSASISDWAAQYVGAMYANQIINGYSDGT
FKPQMPITRAETVQIIDQTEQYSNSRTSSLTILDPNISPSNSSGGKVQGGGIHFGGGTGG
SGDKPSGTSNTYTVTFDLNYEGATGAPAAQKVKKGEKATMPDDPSREGYMFMGWCTDDEC
ATSFEFSTTISSNIVLYAKWTMLQTLNIGYIQADETDIETGTSQSVKFKVKVNTSLS

Enzyme Prediction     

No EC number prediction in MGYG000002132_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
SLH	33	73	9.5e-18	0.9761904761904762
SLH	150	191	2.8e-17	0.9523809523809523
SLH	93	132	1.6e-16	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	6.22e-17	38	196	588	748	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam09479	Flg_new	1.09e-16	252	319	1	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
pfam00395	SLH	3.76e-11	93	132	3	42	S-layer homology domain.
pfam00395	SLH	3.95e-11	150	191	1	41	S-layer homology domain.
pfam00395	SLH	2.10e-10	33	73	1	42	S-layer homology domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU26536.1	5.90e-46	35	198	34	197
AUO19782.1	8.04e-43	3	197	2	198
QGQ95647.1	1.81e-41	27	198	27	201
BAM67143.1	7.74e-41	3	204	10	208
AUO19783.1	2.95e-40	3	318	2	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	8.79e-11	39	201	33	197	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	8.93e-11	39	201	12	176	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]
4AQ1_A	4.11e-06	42	196	12	164	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
4AQ1_C	4.11e-06	42	196	12	164	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
2Y5P_A	5.58e-06	252	318	5	68	B-repeatof Listeria monocytogenes InlB (internalin B) [Listeria monocytogenes EGD],2Y5P_B B-repeat of Listeria monocytogenes InlB (internalin B) [Listeria monocytogenes EGD],2Y5P_C B-repeat of Listeria monocytogenes InlB (internalin B) [Listeria monocytogenes EGD],2Y5P_D B-repeat of Listeria monocytogenes InlB (internalin B) [Listeria monocytogenes EGD]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	8.00e-20	33	196	1682	1851	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38537	1.31e-19	33	199	36	205	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
P38535	7.51e-19	33	196	908	1077	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P19424	2.32e-18	2	196	3	210	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	2.06e-17	40	196	1291	1455	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.808260	0.167686	0.007291	0.000885	0.000524	0.015364

TMHMM  Annotations     

start	end
9	31