CAZyme Information: MGYG000002132_01274

Basic Information

• Species: Monoglobus sp900542675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900542675
• CAZyme ID: MGYG000002132_01274
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002132_50|CGC1	32689.37	4.3551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002132	1988610	MAG	United States	North America

• Gene Location: Start: 5570; End: 6460 Strand: +

Full Sequence      

MNYIVRKDFKTITEALTAANPGDTIIIPSGIYKEKITVDKPNISLVGDGVVTITYDAASG
NPNPDGGTYDTFSSATVTVLNSAAGFKAENITFENNYNRTDPDIKVTQALAISCGADGAV
FDNCNFLGWQDTMYLCCKTRQYVNECYIEGSVDFIFGDATVLFEDCDINCVREKSYITAA
NTSENSDAGFVFYHCYISACEGCGNIYLGRPWRAEQEGINSATAFIECTYNFSAAPEGWL
TWNLKSGTEYANTRYFEYKNVDAHGHLADISHRVPWSRQLLKDEAEALMVSVAKRD

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	290	5.1e-78	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.09e-57	2	294	1	293	Pectinesterase.
PLN02665	PLN02665	3.56e-50	5	285	72	345	pectinesterase family protein
PLN02773	PLN02773	1.37e-49	8	290	16	292	pectinesterase
PLN02682	PLN02682	1.79e-47	8	285	81	352	pectinesterase family protein
PLN02432	PLN02432	6.19e-45	8	285	22	277	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19045.1	4.89e-152	1	294	1	295
AWK06217.1	1.23e-56	8	284	44	311
ARK11951.1	4.36e-54	8	292	33	310
QJR71313.1	1.71e-53	8	295	35	307
QJR66973.1	1.71e-53	8	295	35	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.09e-35	8	276	18	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.45e-34	9	269	19	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	7.77e-34	9	269	19	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.33e-29	7	263	16	309	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	6.69e-28	8	294	14	296	ChainA, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.76e-38	8	285	16	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	4.17e-35	9	291	301	589	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O49298	5.40e-35	4	276	252	516	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
P83218	5.95e-35	8	276	18	281	Pectinesterase OS=Daucus carota OX=4039 PE=1 SV=1
O22149	6.68e-35	2	276	206	474	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999979	0.000049	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002132_01274.