CAZyme Information: MGYG000002132_01832

Basic Information

• Species: Monoglobus sp900542675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900542675
• CAZyme ID: MGYG000002132_01832
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		29882.81	5.1487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002132	1988610	MAG	United States	North America

• Gene Location: Start: 2873; End: 3661 Strand: -

Full Sequence      

MLRPDRTPTRVAGCPPDGYAPKGQLWGNPLYNWAKLAPTGYYWWMERLKGALNMYDVVRI
DHFRAFDAFYAIEYGKPDAVDGEWLKGPGIAFFNAVKERFGNELPLIAEDLGTITDDVRV
LLKQSGLPGMKVMQFGFFPDSDSDYLPHNYGNNSVVYIGTHDNDTLRGWYESQSDETRRF
TADYLRLSEAEGINWGFIKAMLATTADTAIITMQDILYLGSEARMNTPSTSGNNWQWRMR
DMSPLTDVLAEKLNRITKIYSR

Enzyme Prediction     

No EC number prediction in MGYG000002132_01832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	260	6.2e-90	0.5222672064777328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	6.06e-143	2	262	238	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	1.13e-119	12	240	228	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	1.04e-103	1	262	263	525	disproportionating enzyme
COG1640	MalQ	5.68e-91	12	262	254	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.72e-74	2	262	252	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18245.1	9.15e-140	1	262	232	493
QQA12688.1	8.85e-102	1	262	232	492
ALG49936.1	1.77e-101	1	262	232	492
ABG87481.1	2.01e-100	1	262	232	492
AQW27958.1	2.01e-100	1	262	232	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CPQ_A	3.37e-74	1	262	301	563	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	8.92e-72	8	262	268	523	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.82e-71	8	262	320	575	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
2X1I_A	1.56e-70	8	240	240	478	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
6M6T_A	5.12e-70	5	262	240	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	8.90e-95	8	262	232	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q1	5.03e-80	9	262	243	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	5.03e-80	9	262	243	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	6.86e-77	11	262	248	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
Q9LV91	2.40e-73	1	262	313	575	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002132_01832.