CAZyme Information: MGYG000002133_00059

Basic Information

• Species: Prevotella sp000436915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436915
• CAZyme ID: MGYG000002133_00059
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000002133_2|CGC1	37115.07	7.8964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002133	2840923	MAG	United States	North America

• Gene Location: Start: 15359; End: 16342 Strand: +

Full Sequence      

MKLITTTLLLMLSAITAMGANKYDNPDTIFVARDGTAEFRNISEAIEVCRAFMEYHKVIY
VKKGVYKEKLVIPSWLDNIEICGEDRDNTIITYDDHANIKLPETGKGMGTFRTYTLKIQG
NDITLKNITIENNSARLGQAVALHTEGDRLSFINCRFLGHQDTIYTGKATTRQLFKDCYI
EGTTDFIFGPSTAWFESCTIHSKANSYITAASTPANQTYGYIFNHCHLTAADNINKVYLG
RPWRPYAHTLFMNCIMDSHIRPEGWENWRNPANEKTARYQEYNNTGAGANTSKRVGWSHQ
LTKKEAQGITIEKVFHSDTSWLPSCMK

Enzyme Prediction     

No EC number prediction in MGYG000002133_00059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	6.7e-105	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	7.32e-80	31	307	9	288	pectinesterase
pfam01095	Pectinesterase	1.88e-78	31	311	4	291	Pectinesterase.
PLN02432	PLN02432	1.37e-68	29	322	13	292	putative pectinesterase
PLN02682	PLN02682	1.72e-67	28	323	70	368	pectinesterase family protein
COG4677	PemB	1.10e-61	31	315	87	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	4.34e-190	20	327	20	327
QVJ81978.1	9.79e-170	1	323	1	322
ADE82952.1	9.79e-170	1	323	1	322
AGB28242.1	7.90e-167	5	324	4	324
QJR97878.1	9.36e-160	11	323	4	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.57e-46	29	322	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	9.80e-45	31	324	7	306	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.33e-43	31	294	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	7.24e-43	31	294	13	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.50e-33	39	323	18	342	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.76e-59	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	5.58e-50	31	323	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8VYZ3	1.82e-48	33	322	90	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GX86	2.07e-48	26	323	254	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q1JPL7	3.46e-48	29	322	247	546	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999108	0.000166	0.000159	0.000146	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002133_00059.