CAZyme Information: MGYG000002133_00610

Basic Information

• Species: Prevotella sp000436915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436915
• CAZyme ID: MGYG000002133_00610
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002133_15|CGC1	43698.7	9.2078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002133	2840923	MAG	United States	North America

• Gene Location: Start: 6150; End: 7277 Strand: +

Full Sequence      

MKKIIILALAILGLQPAMAKNWTVGEVKDIITKVNNTWQKNHPKQERSFWDPAVYHTGNM
EAAQYLNNNDWYKYSYEWAEKNQWKGARETDKSKWRYEKYGEGHDFVLFGDWQICFQTYI
DLYNSPIAPADKDFMLARAKEVMHYEAYSDKSDYWWWADALYMVMPVMTKMYKISGDKQY
LQKMYENWEYANSIMYDKETGLYFRDGKYVYPKHTTNNGKKDFWARGDGWVVAAFAKILK
DLPKDDAHRKTYISYYKKIVKAVAKCQQAEGYWTRSMVDPEQAPGRETSGTALFAYGIQW
GINNGYLSKKYQKTVDKAWNYLATIAFQPDGTVGYVQPIGEKAIPGQVVNQKSVTNFGTG
AFLLAACEYARHLEK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	371	6.6e-76	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.41e-86	30	373	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.10e-37	150	371	126	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28481.1	1.64e-175	1	375	1	380
ADE82673.1	4.83e-175	1	375	1	371
QVJ79822.1	4.83e-175	1	375	1	371
QUU00388.1	5.78e-170	13	374	16	373
QUT64861.1	2.35e-169	13	374	16	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	6.67e-167	26	375	32	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.97e-146	23	374	12	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	8.04e-51	150	368	147	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.35e-16	148	368	132	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.76e-16	148	368	122	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.65e-50	1	368	1	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.87e-44	132	368	129	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.04e-42	155	368	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.29e-15	148	368	132	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.999033	0.000189	0.000156	0.000151	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002133_00610.