CAZyme Information: MGYG000002133_01024

Basic Information

• Species: Prevotella sp000436915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436915
• CAZyme ID: MGYG000002133_01024
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	MGYG000002133_29|CGC1	95061.49	8.0669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002133	2840923	MAG	United States	North America

• Gene Location: Start: 5799; End: 8297 Strand: +

Full Sequence      

MKKLFIALLSIFLTSFFSPISAKDVVWYNGRGNVEYRVCNKPSPVVKIALGMFSSDMKAV
TGHHAHSVGKAPVEIFQLDMLTNKEMKELDKRKISYTDIITRQDAFTISINQGKIVIVGS
NGRGTAYGILELSRLAGVSPWIYWGDVVPEKKQYLALPDNYFTRQYPSVAYRGIFINDED
WSSRVWAQKIEGKHAKKGEMGPRFYKHVFELLLRLRANTIWPAMHEGTTAFFKVKGNREV
ADSCDIFVGTSHCEPMLRNNVGEWDEKKRGPFNFITNKHNVVNYWAERLHETAGMDALYT
LGMRGIHDGSMLGVKTKEEKLRGLQAVIDEQRKMLHKTFGKSMKNIPQVFVPYKEVLEIY
EDGLKVPDDVTLMWCDDNYGYLTRLSDDEQQKRSGGAGVYYHLSYWGRPHDHLWLTTTQP
GLIFNEMRTAYDHNARQLWIANVHDPKVAAYDLNLFLDMAWNINCVNENTIGNHLKAWLA
QQFGDIVAAKLYPAMRQFYHLCGIRRPEFMGWSQVELDKKKYPRGLSPMQNTQFAADQFG
NELERYINDYEDIKAIVDAAEPLIRPELKDAYFAAIKYPVYGAAAMATKTLQAQEARHLG
RSDSFNHDDEALDAAVRSHKAYQEILSLTDYYNNTMANGKWRGSMDCNPRNLPVFGEPVF
PGKLTADNIKEHSDASPISAKLKTDNTIARNACQWSSASAQAKPIDMLGHSMNAVALPKG
EKLIYEFSTFRSDSCVVRIATIPTQANDKGDIRYQVTIDDQAPVVFSLKEPYRSERWKQN
VLRGQALRSIFTYLPMGKHTITIQALDPHIVVDQWMLDYDVDREFYVFPVER

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	25	815	5.7e-206	0.994261119081779

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	8.56e-166	167	509	3	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.24e-13	713	831	48	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam17996	CE2_N	0.001	729	803	25	80	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28982.1	0.0	22	829	20	825
AII65956.1	0.0	4	831	21	857
QJR53583.1	0.0	4	831	21	857
QJR61620.1	0.0	4	831	21	857
QJR70031.1	0.0	4	831	21	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	6.08e-198	23	823	18	778	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	3.53e-90	115	831	143	848	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	6.85e-88	46	831	37	832	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	9.67e-88	46	831	38	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.13e-75	89	641	83	606	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000235	0.999020	0.000276	0.000159	0.000143	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002133_01024.