CAZyme Information: MGYG000002134_01382

Basic Information

• Species: Mailhella sp900541395
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900541395
• CAZyme ID: MGYG000002134_01382
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		86363.25	5.5744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002134	2752742	MAG	United States	North America

• Gene Location: Start: 36630; End: 39035 Strand: +

Full Sequence      

MSTEDQRPADTPETPLSDTSASSSDAVAVPPAGEPAVPTPDDKLSVSPAAAAPTADDPAP
LMAPEVAAAAAQGELPSRYRPAADKVSSSRTPGARPGKSPKPARPKRVSPAGLTEPGPAS
RLFRRLSLAGLPVLMLLTALMTLSQLLVVRPLWFSDEVRHADVYMRLLEGHWLALNLNGL
PYPDKPPLYFWFLNLLDRIPGVDQPLLFFLGAALSAVLFTGATWLLARATGHDRRVSFAA
GLISLGCLFVAGTAHYPRMDLLFATVITLSLLCLYRGWIKKSGPVWLTFGFVLAGIATLI
KGPLGLAFPLLSSVLFLFWRGTPGRLNGRDGLFGFLLMLIMLSAWMGALLFQGESDYLRD
IFGPQIAGRIVNAWHHAAPWWYYLAALPLIWLPWTLLIPFIDWWKACRRLPAAWKARRED
GGRGWLWLTVIGGTALLSAVSGKIAIYLLPLLPALAVLTARALLLLSPRRSRWFFFCLGL
FFGLLGLLFVAAQFGPRLLPLLPESWTTTLPAVARAYLDNTSGLAFMGLALLLLAVVLLF
FTRRSLPDGSLLSTGLGIVLLMQPYALAVAPSLDTMLSPRAQAEVMAEYVRRGYAPAAYR
VYPGVYAYYLDETLAAAAPDAPRPDTVVPDLNDGAALTAFLAEHPRAVVAMREKDWRRWT
DKPSDIFEIHRQWIVDQPYVLAAREGMTPPATPAPENVPADTAPIPLPEDASGRNAADVP
EFPAASETPPLPELPASPAEPPSNDDSPVENAPAETAAEPAPEFPLTPEADAPSEAPPNG
IESPASPIVPQAATPDGATDL

Enzyme Prediction     

No EC number prediction in MGYG000002134_01382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	130	613	1.2e-68	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.14e-25	150	429	28	301	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.34e-20	150	447	26	317	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.40e-11	184	345	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
NF033913	fibronec_FbpA	8.32e-08	660	798	105	254	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
NF033913	fibronec_FbpA	2.74e-07	688	795	163	277	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS95692.1	1.23e-170	119	729	2	596
ABM28860.1	6.30e-170	111	729	57	659
ADP86283.1	6.30e-170	111	729	57	659
ABB39217.1	1.64e-127	108	692	20	603
BBD06923.1	4.04e-123	120	702	6	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.06e-15	130	469	32	370	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4KC80	3.41e-27	130	488	6	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q4K884	5.83e-27	99	464	11	365	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q3KCC9	6.99e-26	152	481	45	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4ZSZ0	1.93e-25	152	493	29	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q48HY9	2.26e-24	152	472	28	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
127	149
205	227
234	256
285	319
331	353
379	401
421	440
444	466
473	495
523	542
549	571