CAZyme Information: MGYG000002134_02100

Basic Information

• Species: Mailhella sp900541395
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900541395
• CAZyme ID: MGYG000002134_02100
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		92606.08	10.1203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002134	2752742	MAG	United States	North America

• Gene Location: Start: 2981; End: 5569 Strand: -

Full Sequence      

MGENRTLQAKSSRCSPARQRRGTAYAGSRGGSPLAGGGAPAQNDDKPRSAEFAPSKPPSG
LTERHENRSFNGAAKPRPTRNFRAADFISSLDGGGAPVLKRCLFFFALLVLLAFLGLAGA
VGLAPKPDLWGGADFSRVVTDRSGRVLRVTLTRDEKYRIFTPLERIPAAMREAAILYEDR
AFYRHPGVNPLALVRAVAGMAAGGRRMGASTITMQLVRLRDGLDTTTVPGKLRQMWRALV
LERHYDKRAVLEAYLNLAPYGGNVEGVGAAARVWFRKDAALLSLPEIMALVPVPQHPAAR
NPAARRGRALPEARERLAGLWREKYPEVGNLFESAPLAVSGPADLPFEAPHAVAEILARP
DLPEGEIVTTLDLPTQRVVERALKRAVARGRVWGMNNAAALLVDWRDGSVRALAGSADFF
DAGIQGQVDGTAARRSPGSTLKPFVYALALEQGLIHPLTVLADTPRVFRGYEPENADGEF
RGPVSAREALRASRNIPAVALAGRLAPPGLYGFLTGAGVDFPESAEHYGLALVLGGAELS
MRELAGLYTALPGRGMARQPVLLPRERNRARRVLSPEAAYVTLDMLRAPSPSGPTPFTAC
WKTGTSNGRRDAWTVGVIGPYVLAVWVGNFDGAANPGFTGAGAAAPLFFDIARALAAREA
LPDPLRNREGLNLVRIPVCAATGDLNTVLCPEAGGRAETWFIPGVSPIADSGILREILVD
RETGLRQCRDIEGRTERMVWEFWPADLRRLFRQAGINKPPAPPFAPECLDGGPPPGRPPV
ITSPRPGVVYSRSLTRPGPIPLLADTEADADGVFWFAGTRFLGRSGPDEPLLWDPAPGIT
ELRAVDDLGRATSLRVNVETVP

Enzyme Prediction     

No EC number prediction in MGYG000002134_02100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	154	310	3.8e-44	0.8870056497175142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	126	859	1	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	123	859	23	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	6.68e-100	134	651	53	592	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	1.68e-98	172	792	76	707	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	1.84e-96	157	651	1	524	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD89899.1	0.0	120	862	30	780
QTO41888.1	1.48e-252	107	862	28	771
QCC84882.1	2.25e-247	121	862	57	795
SPD36822.1	8.53e-236	132	862	44	772
ATD81196.1	8.53e-236	132	862	44	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	2.22e-29	145	629	143	668	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.37e-29	145	629	164	689	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	1.05e-26	158	629	160	672	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2JE5_A	2.76e-25	164	631	60	609	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3NB6_A	1.48e-21	158	325	20	188	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	3.05e-84	112	855	20	766	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P45345	1.10e-35	151	650	161	699	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
Q9KUC0	4.45e-35	158	631	180	691	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	2.39e-34	108	651	15	593	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P39793	9.67e-32	61	635	5	620	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
102	124