CAZyme Information: MGYG000002135_02005

Basic Information

• Species: Anaeromassilibacillus sp002159845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Anaeromassilibacillus; Anaeromassilibacillus sp002159845
• CAZyme ID: MGYG000002135_02005
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1768		190763.78	3.9682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002135	2740278	MAG	United States	North America

• Gene Location: Start: 5047; End: 10353 Strand: +

Full Sequence      

MKRKTWRSAVALVLAVQMAVASGVTAMAQTNMVALNPSSQASVSVVNDGEEETITRYLSD
MQPAKATVGWGSLMLDEGLENLPLKLRTEDGGTKVYEKGICAHAASELVYDIEGRGVQRF
QSYIGVNYSKTNGTCGFTVKADDEVLFTVDRIAESDPQQYVDVEIPADAKQLILITTTGG
DSNSSDHSVWADAKLILDATVQQNLYKVTASTDKTILDAGETVNISLAGTLVDDSVADLS
SAEISYTSSDDQVATVDGSGAITAVANGLATITCDVTLNSITKSASIDLVVGDEVEGKVW
SVTSPEGNVGGIFMLGSEGNLSYTVQRDEKSVLDFGAMGMKTEIGDFSEGLEFVSVSDAT
TVDETYSVNSHKKAEYRNHYTERTITFMKDGVQFDVVVRAYDDGLAFRYVIHGPEGESYA
VEDEATTFELPAGSNVWAMAYGSGAYSYESHFFKYTAESVSGNQTIPMLYETPDGTFGMI
SEAVLTGYMGSMVVAQDGELKVSATPLQSTDPTVEGTFAFPWRFTVVGTLGDINENTMTE
NLSPAPAEGDYSWAEPGVCSWTWLVGGAGMQSNPDQIKKYIDFASEMGWKYFIMDEGWQP
RSNQGDGTRYFGEYGWIEDVIKYANEKGVGLIAWVHVDDLNTAEKRAQRLDRWAGLGIKG
IKVDFFDRETDERVQLMEDVYADCERLHLVTNVHGANKPTGEVRTHPGILTREGIYGQEM
GDLRAEQYTILPFTRNAVGPADVTETVYPRGNSTTTGFQVALSVLITSGMHCLASSVEDY
QSSPALSFYKDFPSVWDDTHFIDGYPGEFTELARRSGDKWYACAITDEARDAEFKLDFLD
DGEYYAMVYADDGTSNRGLKLEIEKVTKDDTLTVPMKDGGGCAVIFTKEKPSAAETIEFA
EHELTLERNTSTTLDVTITPEEPLITSLIWESSDPTVATVDGSGNITALRPGTAVITATS
PVDDSVSDSCTVTVEMEKYTLDRNTWTIERESSENISFPSETSMIQNSQSGDVDGNADSS
AWPKNMVLFPMKDEDFTATVKVSGGLDTAFQTVALTAFANSNNAASVMRRYHSNFGGNVF
EFMRYQNGYSEPYVADTNPSEDAYLKLERNGNIFKGYYSYDGQEWVQIAEQDCTQLLSQD
NVMLGVYTGNGAGNNNSIQITIEDFTYNDELIPFAVSTETSITDVEPVALGEVYAGTAFE
DLQLPSTVKVTLLNGTEAELPVTWAAGDYDGDTLDTYTLEGAITLENGALNVMDLKATAT
VTVVEAPVEDNTITATYNNKDVTLSVDGEPQKIADLLGKLEMKDVTTGSNVELTFAPRVE
GKNFRSVSIDGAEPELISGDSYTYTVPMEGDGVVLDFVFEVTDKRILEETYNYAKTYVDD
GTVDSLVTAAKEAFMEAYEAAAAVLDDDTATQAQIDAAWNDLLNVIHYLDFQAGDASALE
ELYNILSGLVEDDFTSDSWAAFEEAMTQAAEVIADGEPLEADVTKAYEDLLNAAEGLVRA
SDLSSLNDLIEKAEEVAAEIAEGKYLPDGQEAFQAALDAAKALTKDDAQATINEAAQTLT
EAMAALRKKADKSELEAILNELEALDASDYTATSYAAVAASIANLKTLLADETLDAEEGQ
AVVDNAVAQARAAKANLVEVSNGGSNSGSSSNGSTSANVGNAYGASGVVAAGQNVSAVSA
YVRSDTTVNFTLKHGQAYCFKMTVVNGNAMTPSFTVGNGDVLKTQFVAKIGNDYYYRVYA
IGTPGQSTGVYTTLPGQNAVKHCTVTIG

Enzyme Prediction     

No EC number prediction in MGYG000002135_02005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	298	886	1.6e-150	0.9793977812995246
CBM51	57	195	8.1e-33	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	6.37e-52	550	793	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.52e-47	304	544	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam08305	NPCBM	2.85e-35	57	196	4	136	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
pfam14509	GH97_C	1.20e-26	796	887	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
smart00776	NPCBM	2.63e-22	57	195	6	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18240.1	5.29e-118	301	890	31	618
ATB36826.1	3.15e-104	300	889	25	592
AEE97714.1	4.83e-104	299	891	11	595
ADO69318.1	3.41e-100	297	889	23	594
CCQ33183.1	1.84e-93	301	881	3	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	5.49e-63	304	884	6	638	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	4.33e-62	295	884	12	652	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5XFM_A	9.26e-53	323	885	40	641	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3WFA_A	5.03e-32	302	902	5	721	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.55e-31	302	890	14	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	1.86e-91	296	891	31	625	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	7.52e-63	298	884	21	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	8.98e-31	302	890	25	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
E8MGH9	2.24e-07	1435	1626	1667	1871	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
Q6RUF5	6.08e-06	51	194	37	202	Blood-group-substance endo-1,4-beta-galactosidase OS=Clostridium perfringens OX=1502 GN=eabC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.998934	0.000189	0.000229	0.000170	0.000152

TMHMM  Annotations     

start	end
9	28