CAZyme Information: MGYG000002135_02330

Basic Information

• Species: Anaeromassilibacillus sp002159845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Anaeromassilibacillus; Anaeromassilibacillus sp002159845
• CAZyme ID: MGYG000002135_02330
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1890	MGYG000002135_39|CGC1	203620.24	3.903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002135	2740278	MAG	United States	North America

• Gene Location: Start: 7862; End: 13534 Strand: -

Full Sequence      

MSRRRKGVSKRVLSAVLSAAMVATTIPAMSITASAESAEGNIELSRQVAADGMVLLENRD
EALPVQQGTTVAMFGRAMIDYTRGGGGSGATNVDYTRNILQGMQIKEEEGKISLYQPLVD
FYTEQVTTNGITNDAQINVTDEMMDAAAAAADTAVVTIGRYSSEGSDRSEADYYLTDAEE
KLITRVAEKFDKVVVVLNVGAVMDTSWINDIPGVDAVLVGWQAGMEGGLATADILVGDVN
PSGKLVDTWAKSYEDYPSSKTFNESTSYVNYTEDIYVGYRYFETFDPDYEKVNYPFGYGL
SYTDFKISEVTVDFDGDALTGTANVSATVTNTGDMAGKEVVQVYFSAPQAGEGEAKMSKP
AKELAAFDKTDLLEPGESETLNMSFAISDMSSYDDIGETGHKSAYVMEAGDYDIYVGDSI
KNAGEQGVRGTYNVAETTVTEQLTEKLAPTQLPERLMADGKYHEIEVAPGFDPHHTIAAE
GQTVVQSEAMIGGDVTVEGFYDDNFERLSCIAMMNAVGKYAEYEITVEEAGYYSVMMRYA
NGNADLSNCFTVLVDDEAQPGIHFNAPQTGDGSGAGEWYNFADAEPFYVYLPAGTHTLRL
VANGNNPNYDYMVFEKSDVEISAHQPVSATEPTKIEAEDFEFSGGTNSNYVRTESFTVGD
YNGVCLAYMNYAGNWVSYYLDAEEAGEYDLYFNVANGRARFDWDVGVDVDGTGTENDTIC
VPQTGDGSGASEWYNFEDIGPVTVTLPEGECILTLTCPESSAYPNIDYITVEKHEAVEIP
DEPFETVISATESTRIEAENYSNTGTASGNPVRTEDFTVDETDSTCLAFMNYAGNWVSYN
VYAEEAGDYDVLFNVANGYDPFDWDLGIDVNGVAVENDIVSLEQTGDGSGEGEWYNFVDV
GPVTIPLEQGNNIVTFRCSATNAYPNIDYITFTKADAAAAPAAMRARAFSAKAVAEDPEE
DSKIMLLDVYEARQEGVDLMDEFLDQISDDQLIDMMGGQPNTGVANTGGMGNLMEYGIPN
IMTADGPQGIRIGVNCTAWPIGTLQACTWDVELVEKVGKAAAVEARTNGIDIWLAPGMNI
HRDPLCGRNFEYYSEDPLVAGKMAAALTKGCQSEDVAISLKHFAANNKETNRSSSDSRAS
ERALREIYLKGFEIAVKEADPWTIMSSYNLINGTETSENAELLTDILRGEWGFNGLVETD
WGNNSNHAFELKAGNDVKMSSGSPSTLQNALDRGFITRDDLERSAERLMNLIMKVNTFQN
KIVNPITVDIGDNTTFKAAENILWSETVRAEATKDDGGGNNLGYCDAGAWAEYHINVLTS
GSYNLSARTASSAGSGAFNVLVDGETVASFDVPNTGAYQNWVTQGPQQINLEAGEHTMRI
EWTESGSNLNWLLFERTGELATEHALTVTFPATVELSVGGESQTIANLLGKYTANVMGGD
ALDLAFAPRVEGREIAGVTVNSEAIAEDSFDAAEYVYSAAMPNADTTIELGFTVVDKQNL
RAAIEIAEGRANEAAEAVESVQEKYEAALQAAKDVEAKKTATQNEINTAWSDLIDALHYL
SFVAGDKSQLDIPMEIADSINRDLFTPDSLKALDEAYAAAEDLLDDEEVLEADITAAVDA
LYDAIYGLVYRADVTELEALVNKGDGIVENADQYIQNDAWTSFETSLEEAKTVLANENAT
QDAVDTAAEDLAAAISALRMIPDKDALEALIGEAEAINTSKYTAKSVATMKAALSTAKAV
LNDAEATEEEVADAVEALENSIDGLVEKSTSTSSKGSTSANVGNAYGAAGVVSASQSVAA
NAYVVSDTTVNFTLKRGSAYCFKMTVVNGNAMTPGFTVGNGDVLKTQFVAKVGNDYYYRV
YATGTPGQSTGVYTTLPGQNATKHCTVTIG

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1016	1219	1.6e-68	0.9629629629629629
CBM6	1277	1395	1.9e-24	0.8695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.72e-53	1017	1264	59	324	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	7.01e-39	45	419	387	754	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	8.91e-35	1017	1251	65	316	Glycosyl hydrolase family 3 N terminal domain.
cd04080	CBM6_cellulase-like	1.60e-31	1285	1395	33	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam01915	Glyco_hydro_3_C	3.18e-30	53	279	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE95841.1	5.13e-184	39	1256	48	807
QIB55852.1	9.80e-183	39	1256	26	785
QMW76281.1	9.80e-183	39	1256	26	785
QAA32414.1	2.02e-170	43	1256	30	807
AEN98460.1	1.36e-169	31	1256	21	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	9.70e-110	39	1394	34	954	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	6.45e-66	998	1260	30	312	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.96e-65	998	1260	30	312	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.15e-54	1015	1252	34	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.71e-52	1017	1279	36	312	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	2.48e-144	37	1243	24	812	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	5.24e-65	42	464	10	425	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
Q5BFG8	5.69e-57	1015	1263	40	297	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
E7CY69	2.70e-54	1017	1279	36	312	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P14002	6.32e-54	1015	1252	34	286	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.998973	0.000183	0.000227	0.000180	0.000143

TMHMM  Annotations     

start	end
12	34