CAZyme Information: MGYG000002136_00959

Basic Information

• Species: UC5-1-2E3 sp001304875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UC5-1-2E3; UC5-1-2E3 sp001304875
• CAZyme ID: MGYG000002136_00959
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MGYG000002136_6|CGC2	49865.91	4.2498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002136	3193765	MAG	United States	North America

• Gene Location: Start: 18337; End: 19710 Strand: +

Full Sequence      

MEFKRLKTYLALAAVMGTTLVQAPVTAWAIGPGETGSSVSSSSSGPSQKGPGVSQDSSAE
AETPKNPYAWERVNGVYQMEDGSPIDGVYARGIDVSHWQGEIDWRKVAGDDVSFVMLGTR
YDGQLDPRFHQNIQGALNNGIQVGAYIYSYATTPEMAAAEADFVLNAVRGYNITYPIVFD
VEATVMRSLSKEELTAIVNTFCQRIEQAGYQTAVYANEYWLYNLLDMSSIPYDVWVARYG
VKYTYSNPYMWQATNTGSIEGINGNVDIDFQFKSSPHGQKVSSGGPGVSGPASGSSSGPS
TSGSGSGTSGPSAPGSSSGTSGQNTPVQPIAPGQTVMGWVDRDGTWYYYGANNQMVTGWL
QDNGDWYYLDFDGSMEKGWTMVSDKWYYMRDDGSMVIGWRQIGGFWYYFQGDGQMATGWL
QVDGGVYYLDENGRMKANETFTVDGVQYTAREDGRCN

Enzyme Prediction     

No EC number prediction in MGYG000002136_00959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	93	262	3.4e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.32e-77	91	272	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033840	PspC_relate_1	8.42e-43	322	454	495	627	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033838	PspC_subgroup_1	6.00e-39	325	435	477	604	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	3.07e-38	333	435	459	561	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.07e-37	331	435	520	624	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR03194.1	4.61e-90	10	273	14	283
ANU47907.1	4.61e-90	10	273	14	283
QIX91481.1	1.81e-87	10	273	14	283
QRP37172.1	1.87e-86	10	273	14	283
QJU23033.1	1.87e-86	10	273	14	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.24e-17	93	272	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	5.34e-17	93	272	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRU_A	7.94e-16	91	269	21	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	3.84e-15	91	269	21	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	4.61e-14	91	267	6	198	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.58e-14	92	269	69	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	7.09e-14	92	269	69	252	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	9.58e-14	92	269	69	252	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	1.26e-13	84	267	76	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	2.81e-12	91	273	10	197	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000463	0.998732	0.000224	0.000222	0.000173	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002136_00959.