CAZyme Information: MGYG000002136_02446

Basic Information

• Species: UC5-1-2E3 sp001304875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UC5-1-2E3; UC5-1-2E3 sp001304875
• CAZyme ID: MGYG000002136_02446
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1286	MGYG000002136_27|CGC1	146413.01	5.2529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002136	3193765	MAG	United States	North America

• Gene Location: Start: 2822; End: 6682 Strand: -

Full Sequence      

MRDASYEILDMLDQYGKDTDGALMNGEGPEVLYAFSAMRENLLEWFPFVAEKKLLQVGGG
YGALTGLYARKVREVVVLDPVDESREVVRRRHAGLNNLRLENGSLPGWETAERFDYVVFV
GSLTDRWREEMEAAKGLLAPGGVIIAAFDNRLGMRYWNGASRPGGEAMLSFNEMKLAFPD
GQVYYPVPDYRMAVSLYSDRCLPKKGELTNVAVSYDAPRYLFSDEEAAFDAVCGEGRFAE
FANSYLVILGDVSLTDEYVKYNRTRKPRFQLKTSIGTGADGKKYVRKSALSEAGRDHIQS
FEKKYSLLKDMNPRLKILEPELLDGGMTASFPFLTGETMDERLARQIADGEIPAEALQKA
IDEVLYAELSHTVTFEVTPAFTEVFGEIPPLSDHAYTASNIDALFENMMVCGGNIYCLDY
EWVFEFPVPAHYVQYRNLSYFYRKYKGLLTCGSLEEFLKPFGITAEMVSVYDSMEAHFQS
YVHGAEGNDLLERYRQPVKTLEELAAQDQELSRAKDRILQLQAEVEEKNLNIRKINEVQR
LTNNHVTNLEVMIGDLRHEIGEMAKTIDYLNRHEAILFKIKRKLGGVVNKAFPKGTRKRK
ILKYCKNTLLHPAKYLKLYTTAEGRNLIHGDFEIGEDYLTHGRLHFDQVENPTVSIVIPV
YNQIHYTYACLVSILEHTKDVTYEVIIADDVSTDATEHLSDYAENLVICRNQTNQGFLRN
CNQAAKAARGKYVMFLNNDTQVTPGWLSSLVNLIGSDPTIGMVGSKLVYPDGRLQEAGGI
IWSDGSGWNYGRLDNPDKPEYNYVKDVDYISGAAILLSNELWKQIGGFDERFAPAYCEDS
DLAFEVRKAGLRVVYQPLSKVIHFEGVSNGTDVNGTGLKRYQVENSRKLKEKWADEFKKQ
CVNTGNPNPFRARERSMGREIILVVDHYVPTFDKDAGSKTTFQYLKMFLKKGYVVKFLGD
NYLHEEPYSTTLQQMGIEILYGPEYQTGIWDWLKENGSEISYAYLNRPHIATKYIDYIKD
HTDIKVIYYGHDLHFLRERREYELTGDIQKKRESDYWKSVEFTLMYKADISYYPSYIERD
AIHQIDQSIRVKAITAYVYEEFLKNINKDFARREGLLFVGGFAHPPNADAVLWFAREIYP
RIREKAEIPFYIVGSRVTDEIRALQEPGNGITVYGFVSDEELARLYASSRLVVVPLRYGA
GVKGKVIEALYNGSPIVTTSIGAEGIPFAGEVLAVADEPQEFADRVLQMYEDAEGLAGIC
DKTQEYIRNYFSVDAAWSVIREDFTR

Enzyme Prediction     

No EC number prediction in MGYG000002136_02446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	655	904	7.6e-26	0.8813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.34e-48	656	865	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.09e-43	651	870	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13692	Glyco_trans_1_4	8.54e-25	1116	1252	4	138	Glycosyl transferases group 1.
pfam00535	Glycos_transf_2	9.36e-24	655	775	1	124	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	7.29e-23	646	857	48	258	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN93838.1	0.0	1	1284	1	1313
QRP41495.1	0.0	1	1284	1	1313
QJU21849.1	0.0	1	1284	1	1313
QIX92521.1	0.0	1	1284	1	1314
ANU46567.1	0.0	1	1284	1	1314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XHB_A	8.20e-08	652	898	29	291	TheCrystal Structure of UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase-T1 [Mus musculus]
6E4R_A	5.42e-06	684	897	103	329	CrystalStructure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9B [Drosophila melanogaster],6E4R_B Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9B [Drosophila melanogaster]
6E4Q_A	5.44e-06	684	897	103	329	CrystalStructure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_B Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_C Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_D Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.93e-19	652	893	625	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.44e-17	652	872	574	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q48455	1.05e-13	1116	1283	213	388	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q8MYY6	2.82e-12	654	898	112	381	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2
P9WMY2	1.71e-09	685	872	35	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002136_02446.