CAZyme Information: MGYG000002136_02453

Basic Information

• Species: UC5-1-2E3 sp001304875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UC5-1-2E3; UC5-1-2E3 sp001304875
• CAZyme ID: MGYG000002136_02453
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266	MGYG000002136_27|CGC1	30478.21	9.2829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002136	3193765	MAG	United States	North America

• Gene Location: Start: 11705; End: 12505 Strand: -

Full Sequence      

MVKIKPENHTFVICAYKESPYLEECIRSLKNQSVRTNLRMATSTDNGHIRALAEKYGIPL
DINPGPGGITQDWNFAYSRAGTPLITLAHQDDVYCRDYAKEILACAARAKRPLILFSDYG
EIRNGARVRENMLLKIKRMMLIPLEFGALSGSRFVRRRILSFGNPISCPAVTYARENLPE
PVFSDGYTCVEDWQAWERISRLKGQFIYCKKLLMYHRIHEESTTSGMIGDTGRGAEDLEM
FEKFWPKPIARLIGRLYSVSERSNRL

Enzyme Prediction     

No EC number prediction in MGYG000002136_02453.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	4.90e-07	10	158	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.03e-06	12	110	2	106	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	2.03e-04	11	130	5	132	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	3.91e-04	10	187	6	187	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	5.33e-04	12	224	3	210	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44259.1	1.70e-112	8	266	7	265
ASU27515.1	4.76e-110	7	266	7	266
ANU74711.1	4.76e-110	7	266	7	266
QQQ92258.1	4.76e-110	7	266	7	266
QJU15234.1	4.76e-110	7	266	7	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002136_02453.