CAZyme Information: MGYG000002139_01567

Basic Information

• Species: CAG-877 sp900552495
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877; CAG-877 sp900552495
• CAZyme ID: MGYG000002139_01567
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42479.48	5.103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002139	1540464	MAG	United States	North America

• Gene Location: Start: 14643; End: 15788 Strand: +

Full Sequence      

MKKIILIVTVIVLLGGIGSYFYVNSRVEEKDLKVPEEISSDDLFGKYYPQAERKLKQMSL
EEKVGQLFLVRYDASASIKQITDYYAGGFVLFAKDFQNHTKESIKKELEARQELSKIPLA
LAVDEEGGYVTRVSRFPQFRSEKFKSNKELFETGGYELVKASEKEKAELLLGLGINLNLA
PVADVSTDSNDYMYIRTFGRDAKETATFIANIVRYNEEAGLSSCLKHFPGYGNNLDTHGG
IAIDNRSYENFVNNDFLPFKSGIEASVPAVLVSHNKAMAIDSKYPASLSKKVIAELRETL
DFSGIIITDDLAMGAVLEYVNENVSATLAINAGNDMIITSDYEKMYNEVLNGVSSGTIKV
ETIDIAVRRIIAWKYAYGICK

Enzyme Prediction     

No EC number prediction in MGYG000002139_01567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	338	3e-40	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	3.39e-52	59	371	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	3.88e-45	58	379	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	4.15e-25	87	337	27	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	5.14e-17	55	379	42	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW43722.1	9.56e-117	1	379	1	387
QHQ63470.1	1.39e-115	50	381	84	415
SET88834.1	8.92e-109	24	381	67	418
BCJ98858.1	1.55e-108	47	381	124	458
QWT55932.1	1.22e-105	46	381	103	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.60e-35	56	374	9	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.68e-31	51	378	35	397	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.98e-31	51	378	9	371	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.92e-31	51	378	39	401	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	1.17e-26	59	374	8	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	9.21e-31	51	378	35	397	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q31G32	6.97e-26	79	357	29	308	Beta-hexosaminidase OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=nagZ PE=3 SV=1
L7N6B0	2.03e-25	58	374	59	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	5.23e-25	58	374	59	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
P48823	1.66e-24	81	338	59	334	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.819332	0.160742	0.018557	0.000301	0.000227	0.000846

TMHMM  Annotations     

start	end
4	23