CAZyme Information: MGYG000002140_02830

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_02830
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000002140_27|CGC1	34703.36	6.1777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 25488; End: 26405 Strand: -

Full Sequence      

MTANTYTLTNPSAQDSAARLYSFLSSLKGKGILSGQQECPEDKTNGDELSYIQKVSGHLP
AILGLDYIGNDFDGVNRRAIAWHKKGGIVSICWHWGIPPYGLGYPSSQESVDMTKLLTPG
TALYQGLLDNLDAVANALKVLCEAHIPVLFRPLHEFDGAWFWWGKGGAEPFKKLWQLMYN
RFTNLHRLNNLIWVLGYSHEMHDGWYPGDAYVDIIGADAYTEGIHEELYEKLKKITDKPM
PVCHHENGPIPEPGLLALKNIDWCWFLTWHTIHIHEQNSPDYIHYVYNHPYVITLENLSG
FYESR

Enzyme Prediction     

No EC number prediction in MGYG000002140_02830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	296	2e-88	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.17e-53	10	294	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	9.03e-14	146	239	180	271	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	1.31e-130	8	298	6	296
ADU20874.1	1.63e-96	8	303	167	464
AJP70762.1	7.00e-92	8	298	22	318
AOW25662.1	7.28e-90	17	300	10	296
ATC26721.1	5.15e-85	8	298	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	8.67e-60	8	300	145	449	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	2.84e-53	10	298	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	2.99e-51	11	300	37	354	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	1.84e-48	10	298	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	1.32e-43	17	279	54	324	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.61e-60	8	304	174	482	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.20e-52	8	298	146	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.76e-50	12	295	32	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
Q5AWB7	4.11e-47	10	300	30	352	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	7.70e-40	7	301	156	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002140_02830.