CAZyme Information: MGYG000002146_00737

Basic Information

• Species: CAG-145 sp900542295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; CAG-145; CAG-145 sp900542295
• CAZyme ID: MGYG000002146_00737
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		77824.33	4.6457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002146	1965168	MAG	United States	North America

• Gene Location: Start: 108775; End: 110889 Strand: +

Full Sequence      

MNRKVLALLVLFVLTAGSLVQACGASTDSKYTGATYEHNKKFENADVINGIDVSQYQNEI
DWNKVKDDGVEFAVIRVGGRGYSEMGRMYFDDYYKKNIEGAKKAGIDVGVYYFSQAKTEA
EAVEEAEHCLSLLGDYEIDMPVYMDYEHASDLLNPGRIKNLTKEQRTKNVMAFCERIKES
GYEAGFYSNLLFLRNSVDGKTIGEKYHVWAAQYNNKCSYENDYGIWQYSSKGKVNGINGI
VDCNFQYKLDISGFDVQLSFLSSVYDGEEKKPEVTISDLKENVDFTLEYKNNINAGEARV
AITGKGLYKGRKEIPFDIEVADIKDRNVTLSYSEIEYDGNAKEPEVSVEGLALGRDFNVT
YSDNVRVGTAAVTITGTGNYKGVIITNFVIKDTKTGAEALFKDSNKVRIYGSDRYETAIN
AAEALKISLGRNKFDSVIIACGDDYADALSGSYLASVKKAPVLLVNRYNELRVKNYIEGN
LENDGTIYILGGEGAVSKGFEDSFLEYKTIRLGGSTRFETNIAILEEAGVKGKDLLVCSA
FDYADSLSSSSAGRPILLIDENLNDIQEAYLKGAAGDSSLEKCYLIGGEGAVSKTAEQEF
KGIFKSVERLGGQNRFETSLAIANEFFDRESKVVTLAYGYDYPDGLTGGAVAESVNSPVL
LVSEKNIYYAKKYVRSISADRVVVMGGHILVPDEQVYEIMNHTL

Enzyme Prediction     

No EC number prediction in MGYG000002146_00737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	51	237	1.2e-50	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	4.71e-74	48	247	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.96e-27	50	244	2	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.29e-27	51	237	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.13e-26	49	245	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam04122	CW_binding_2	3.48e-22	408	498	1	79	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL98623.1	9.19e-59	26	250	26	254
ADU22705.1	3.71e-49	26	247	85	306
QCT06482.1	3.54e-47	36	244	111	313
CCO05379.1	9.94e-47	24	247	79	303
CBK74089.1	1.31e-46	50	248	326	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J6Q_A	7.14e-22	379	665	264	553	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
4KRU_A	1.32e-16	48	244	20	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.05e-16	48	244	20	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
7ACX_B	9.73e-16	404	625	38	280	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACY_B	1.30e-15	404	625	38	280	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	4.00e-18	403	687	25	301	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P34020	1.87e-14	48	242	1	176	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	1.76e-13	44	297	5	241	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P76421	3.65e-12	48	244	67	252	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.65e-12	48	244	67	252	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000082	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27