CAZyme Information: MGYG000002148_00088

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_00088
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000002148_1|CGC2	37880.77	4.6748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 99091; End: 100110 Strand: +

Full Sequence      

METFSFVKHARLMGRFDCQNPETPVAAWVNSAVFLTFEGEEIWMRAEDSDGEDYLEIILD
GVARNWIGLKKGVGDYRIEAEVPEGIHTLEIHKRTELLMGRVTFLNFYLPKGGQFLDPPE
AHGLRLEYFGDSITNGCGNGHPHEVAHAPALDNGYMSYAGLSARMLSAEYHTIAISGIGI
LQDAMGNINGLPPHFHGVHGFDTPDWDFSQYIADGVIINLGQNDYSNPISDDLYVEKYIA
FIEDILQQYPQAYVFCCVGTMNNNYLPSVERVTGHFRALGNEKVFLVDLGLIIPEVEGWG
GGFHPGFQTHYRMAQDLAGFISEKTGWPLRERPVIATKC

Enzyme Prediction     

No EC number prediction in MGYG000002148_00088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	125	321	9e-48	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	3.20e-37	125	321	1	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	4.26e-29	13	119	2	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	2.72e-11	129	305	2	169	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	5.59e-07	129	318	4	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam00657	Lipase_GDSL	0.006	129	269	4	144	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98015.1	2.49e-169	4	339	3	337
QOT10774.1	2.12e-164	1	339	1	339
ACX67070.1	3.01e-164	1	339	1	339
AYB42844.1	6.06e-164	1	339	1	339
QUL58359.1	9.65e-158	13	339	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	3.36e-49	14	327	15	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	9.32e-49	14	327	15	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	3.61e-25	11	327	3	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
3U37_A	8.70e-16	12	327	51	406	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	1.70e-14	12	327	51	406	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.41e-45	14	327	496	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_00088.