CAZyme Information: MGYG000002148_00186

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_00186
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000002148_1|CGC4	37121.96	4.7499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 210157; End: 211122 Strand: +

Full Sequence      

MNQTMAPANPNAQQEVKEMLHYFESIAGKKMILGQHTQTMEQAELHFIEDATGKLPALCG
FELLSYSPNINYEESGEECLTEVREAQKTLQKAWEWAEKKGLITFTWHWFSPTGGKDKAF
YTEHTEFSAEQAVLDGTEENKALIADMDFMAGLLKPFCEAHIPILWRPFHECDGTWFWWG
RDGAETVKKLYRIMFERFTYRYHLDNLIWVFNAASGDFYPGDDVVDIISCDMYPEAHHHT
DCAEALENLKKITSARKLYAIGEIGTIPDVRAVIEHGLDWIYYMTWSKDFGKTELFTSRD
ELRRAYDDPGAVTLAQFPKFY

Enzyme Prediction     

No EC number prediction in MGYG000002148_00186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	314	7.1e-92	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.70e-48	9	287	2	283	Glycosyl hydrolase family 26.
COG4124	ManB2	1.64e-14	162	233	180	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK45707.1	1.93e-141	5	321	4	321
AIQ67637.1	1.23e-140	7	321	9	324
CQR54080.1	1.01e-139	1	321	1	324
QUL56288.1	2.03e-139	6	321	8	324
CBL34621.1	5.40e-139	7	321	8	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.64e-61	7	313	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	6.07e-52	9	314	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.11e-48	2	290	29	322	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	3.48e-39	12	320	50	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	7.44e-35	5	287	21	300	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	4.41e-52	4	294	25	327	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	7.11e-52	9	314	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	7.38e-52	2	314	21	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	2.06e-50	7	318	139	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	8.78e-42	9	320	158	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_00186.