CAZyme Information: MGYG000002148_01454

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_01454
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000002148_9|CGC3	32954.27	5.5166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 40463; End: 41314 Strand: -

Full Sequence      

MVAVQLSGGLGNQMFEYALYLKLKALGKEVKIDDFTCYGSGQRTKQLDVFGLSYDRLTRE
EYEKLTDSSMQPAARLRRKLTGRKDLSYREADINFDEKVLETEPVLLQGCFQTERYFEDI
AEEVREAFRFRNFAPNARTRDYERQITESCSVSVHIRRGDYLDPKYSGLYEGICDEAYYE
RAIRQMKALLPDAVFFFFSNDIGWVKEHYSGEAYVAVEGNGEDTGYADLWLMSKCRHHII
ANSSFSWWGAWLNDAPDKKVIAPKRWLNGRDCRDIYTKEMILL

Enzyme Prediction     

EC	2.4.1.69

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	278	5.8e-72	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	8.67e-70	6	271	7	260	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	3.44e-26	1	266	1	278	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	1.18e-05	7	256	7	284	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97425.1	1.10e-81	1	280	1	285
ADL35260.1	1.26e-80	1	280	1	285
SNX52916.1	6.43e-61	1	271	1	273
QJH95358.1	1.30e-52	1	283	1	292
QPH38835.1	3.01e-52	1	274	1	275

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	3.41e-32	6	271	5	290	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q10980	4.53e-09	152	252	216	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Fut1 PE=2 SV=2
O09160	6.10e-09	152	252	217	319	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2
Q10984	1.39e-08	149	264	204	334	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Fut2 PE=1 SV=2
P19526	1.43e-08	152	252	215	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_01454.