CAZyme Information: MGYG000002148_01660

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_01660
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000002148_11|CGC2	77522.25	6.2422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 67316; End: 69313 Strand: +

Full Sequence      

MASKVKERLQQTLVKKRTRWYEEQIAAQDISYNSWIKEKEKQERECLSLKGKDLKMEVVS
YDECLGDFSFDRYQQADVLIFHAPDGTPDMRELAMVADYFVRHPQTVVLYADEDEVDEKG
VRKNPWLKPDWSPDTLISYFYFGGFFAVRREECSHLKWLGDENVRRNLYDFVLKAVEITG
SAEHVDSVLFHRRKIQPWGQEEAYDDLKRAAYLRRKWPMRPEGKVSVIIPSKDNPGVLSD
CIHSVMEASTYRNFEIIVVDNGSNAHNRERIQRMREMLQEKYRFVYHYEPMEFNFSRMCN
IGAELATGDYILLLNDDIEITQENWLELMMEKAVLPHVGAVGAKLIYPGTEIIQHAGITN
IHLGPAHKLQFRSDANEYYFLKNRLPFDVLGVTGACLLVKKRIYEQAGGLSEKLRVAFND
VEFCYHLHDLGYYNVVRNDVTLVHHESLSRGADDSTEKLRRLHQELNLLYEMHPSVYGRD
PFYHRYLIKDVLDAEYFTGCRYDFDKRVEKVLPQKLENGLPPEWHNEVLRMGIEFAGDMQ
RWQTGKSGGGDWLIQGWSWALIVDNCRYNFSLLLKPVEKGYLAEGSSESAVPEDRKTIWK
LPCTRQYRPDIDANLNGIIHTKLPGVCVTFERNSIPAGEYLIGFLWEDTCSRQKLYRFCA
ETLSV

Enzyme Prediction     

No EC number prediction in MGYG000002148_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	226	405	3.3e-22	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.27e-31	227	446	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.99e-25	224	479	4	256	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	3.72e-21	93	194	101	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	5.04e-18	226	404	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.22e-17	227	347	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95571.1	2.57e-115	5	665	2	701
QNM02107.1	3.29e-114	5	664	3	666
ADL33298.1	6.10e-113	5	665	2	702
CBK92935.1	6.84e-99	103	496	168	585
QUF73846.1	4.40e-97	109	656	815	1352

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.62e-47	85	484	458	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.77e-45	75	453	401	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	5.51e-06	225	332	5	107	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_01660.