CAZyme Information: MGYG000002148_01980

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_01980
• CAZy Family: CBM50
• CAZyme Description: Gamma-D-glutamyl-L-diamino acid endopeptidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		47878.2	4.5669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 78390; End: 79676 Strand: -

Full Sequence      

MRTLFQGDRGTLVKYLQLALTRAGYPTEIDGIFGRATCAMLREFLGAAVPCAVDAEVWRK
LEPYLKGFVNAVVRAGDTVYEFARRYRTREEAILRANPTLAPENLQIGSNIVIPLDFPLT
PENVEPSSFLNAWIVEGLLARYPFLKSSSIGNSVMGRPLLCLRIGNGEKEVFYSASYHAN
ESITTPLLLKFAEEYAEAYAEGKELYGGSAAGLFENFSLYLVPMVNPDGVDLVNGILGER
DFVWRDFYRQAARIAADYPQIPFPDGWKANIDGVDLNLQFPAGWENARQIKYAQGYTSPA
PRDYVGSAPLVAPESAAVYNFTREHDFSLILAYHTQGEVIYWKYLDYEPERSREIGEYFS
RVSGYTLELTPDLSGFAGYKDWFIQDYNRPGYTIEAGAGENPLPMALFGGIYEDNKGIFL
GGMTQINI

Enzyme Prediction     

No EC number prediction in MGYG000002148_01980.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06229	M14_Endopeptidase_I	3.60e-90	171	419	1	238	Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I. Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3.4.19.11). ENP1 is a member of the M14 family of metallocarboxypeptidases (MCPs), and is classified as belonging to subfamily C. However it has an exceptional type of activity of hydrolyzing the gamma-D-Glu-(L)meso-diaminopimelic acid (gamma-D-Glu-Dap) bond of L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid and L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid(L)-D-Ala peptides. ENP1 has a different substrate specificity and cellular role than MpaA (MpaA does not belong to this group). ENP1 hydrolyzes the gamma-D-Glu-Dap bond of MurNAc-tripeptide and MurNAc-tetrapeptide, as well as the amide bond of free tripeptide and tetrapeptide. ENP1 is active on spore cortex peptidoglycan, and is produced at stage IV of sporulation in forespore and spore integuments.
smart00631	Zn_pept	8.06e-38	130	412	7	277	Zn_pept domain.
cd00596	Peptidase_M14_like	2.39e-25	171	419	1	216	M14 family of metallocarboxypeptidases and related proteins. The M14 family of metallocarboxypeptidases (MCPs), also known as funnelins, are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavage. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.
pfam00246	Peptidase_M14	1.20e-24	130	395	1	261	Zinc carboxypeptidase.
cd03859	M14_CPT	1.15e-22	130	415	10	288	Peptidase M14 Carboxypeptidase T subfamily. Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPT has moderate similarity to CPA and CPB, and exhibits dual-substrate specificity by cleaving C-terminal hydrophobic amino acid residues like CPA and C-terminal positively charged residues like CPB. CPA and CPB are M14 family peptidases but do not belong to this CPT group. The substrate specificity difference between CPT and CPA and CPB is ascribed to a few amino acid substitutions at the substrate-binding pocket while the spatial organization of the binding site remains the same as in all Zn-CPs. CPT has increased thermal stability in presence of Ca2+ ions, and two disulfide bridges which give an additional stabilization factor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21589.1	2.39e-196	1	426	1	439
QWT55181.1	8.84e-162	1	425	1	425
CDZ24839.1	7.50e-132	1	422	1	420
AUS95891.1	7.75e-132	1	420	1	418
AGC68495.1	2.37e-117	1	420	1	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PRT_A	1.84e-09	135	395	19	277	Mutantof the Carboxypeptidase T [Thermoactinomyces vulgaris]
4IAV_A	1.87e-09	135	395	19	277	G215S,A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris with N-Sulfamoyl-L-phenylalanine [Thermoactinomyces vulgaris],4IHM_A G215S, A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris [Thermoactinomyces vulgaris],4IK2_A G215S, A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris with N-BOC-L-Leu [Thermoactinomyces vulgaris]
3QNV_A	4.38e-09	135	395	19	277	CarboxypeptidaseT [Thermoactinomyces vulgaris],4DJL_A Carboxypeptidase T with N-sulfamoyl-L-phenylalanine [Thermoactinomyces vulgaris],4F8Z_A Carboxypeptidase T with Boc-Leu [Thermoactinomyces vulgaris],4GM5_A Carboxypeptidase T with Sulphamoil Arginine [Thermoactinomyces vulgaris],6GO2_A Carboxypeptidase T with N-sulfamoyl-L-Leucine [Thermoactinomyces vulgaris],6SN6_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-GLUTAMIC ACID [Thermoactinomyces vulgaris],6T9Y_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-LYSIN [Thermoactinomyces vulgaris],6TNK_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-VALINE [Thermoactinomyces vulgaris],7Q87_A Chain A, Carboxypeptidase T [Thermoactinomyces vulgaris]
6F79_A	4.38e-09	135	395	19	277	CarboxypeptidaseT mutant L211Q with Sulphamoil Arginine [Thermoactinomyces vulgaris]
1OBR_A	4.45e-09	135	395	19	277	CARBOXYPEPTIDASET [Thermoactinomyces vulgaris],3V7Z_A Carboxypeptidase T with GEMSA [Thermoactinomyces vulgaris],4DUK_A Carboxypeptidase T with L-BENZYLSUCCINIC ACID [Thermoactinomyces vulgaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03415	4.14e-80	69	423	1	394	Gamma-D-glutamyl-L-diamino acid endopeptidase 1 OS=Lysinibacillus sphaericus OX=1421 PE=1 SV=1
P54497	2.12e-63	135	418	93	367	Uncharacterized protein YqgT OS=Bacillus subtilis (strain 168) OX=224308 GN=yqgT PE=3 SV=1
P18143	2.30e-14	46	395	39	400	Zinc carboxypeptidase OS=Streptomyces griseus OX=1911 GN=scpD PE=1 SV=2
P15088	1.46e-08	132	377	127	328	Mast cell carboxypeptidase A OS=Homo sapiens OX=9606 GN=CPA3 PE=1 SV=2
P29068	3.48e-08	135	395	117	375	Carboxypeptidase T OS=Thermoactinomyces vulgaris OX=2026 GN=cpt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_01980.