CAZyme Information: MGYG000002148_04015

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_04015
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000002148_63|CGC1	97126.03	5.2504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 10139; End: 12634 Strand: +

Full Sequence      

MNRIVLHENWQMRELQQEEWIPAVVPGSVYSDLLRNNRMEDPYYRDQEEKALALMDHDFE
YRTSFEVPEDIWQEEEILLTFLGIDTAADLYLNGIHLGYVENMHRTWEFSVKKHIRKKGN
ELKAVLYSPTRLIEKAYEEDPLEGSEDAMRGFPKLRKAHCMFGWDWGPRLPDAGIWREVF
LTGFSNARMDSVYVIQRHEKTTGKNSGDGCLDVWLELQVSMKTAGAQSVRIQPGNTAFKE
YGFRASLIHPDGRVSRYEENEELLAVEKPQLWWPNGYGDQPLYLLRVELLYQEQVLDTWE
RRIGLRTMTMDIRKDAYGESFAHEVNGIQIFAMGADYIPEDNIRGRVSKERTRALLQQAK
AAHFNCIRVWGGGYYPDDAFWDACDEMGLIVWEDFMFACAVYHLTEEFENNIRAEFIDNI
KRIRHHACLGLWCGNNEMEMFMKSRRWPCHPQRVSDYVKMYEYILPQVLKEYDPCTFYWP
ASPSSGGAFDEPNDENRGDVHYWDVWHGNKPITEYRKFYFRYVSEFGFQSFPSLKTCETF
TLPEDRNIFSYVMEKHQRNKTANGKIMNYMEQTFLYPGTFELVLYASQLLQAEAIRYGVE
HFRRNRGRCMGTIIWQLNDCWPVASWSSIDYCGRWKALHYCAKRFFAPLLLSCAEEGILT
QDTNPNAQPYQVKKSIRLCVSNETMQKQNVTVCWALRGSDAGIKREASVRVEADALSSLW
LPEEDMEDASLYSDYVSYEMIKNGEVISSGTVLFCAPKHFRFRDPHLQVRAEGNSLIVSA
DAYAKGVEILNEEEDMLLEDNYFDMNAGERRIRILKGRPEGLKIRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000002148_04015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	726	1.1e-103	0.6968085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.72e-88	3	657	12	640	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.90e-10	61	437	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	3.05e-09	764	829	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	4.66e-09	676	759	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	8.27e-09	8	307	32	277	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	6	831	6	816
ADL35923.1	0.0	6	827	6	820
QBE97789.1	0.0	6	831	20	837
QIB54534.1	0.0	6	831	6	823
QMW79049.1	0.0	6	831	6	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OP6_A	1.91e-147	4	830	11	842	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	2.47e-147	4	829	9	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.61e-147	4	829	11	838	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	5.02e-147	4	830	9	840	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	2.91e-145	4	829	9	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	6.73e-107	1	821	4	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1CGA8	1.31e-106	1	821	4	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B0YBU9	2.55e-106	1	821	4	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	1.93e-104	1	821	4	834	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q0CCA0	5.11e-103	6	656	9	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_04015.