CAZyme Information: MGYG000002149_00427

Basic Information

• Species: Blautia sp003287895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp003287895
• CAZyme ID: MGYG000002149_00427
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000002149_2|CGC2	80826.67	5.0935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002149	2886615	MAG	United States	North America

• Gene Location: Start: 174087; End: 176183 Strand: -

Full Sequence      

MAIMNYDNRVFALQTKNTSYILGISENGTLENLYWGKKIEHGEDFLGESGKNPTINMQEP
QNVREECSSFGGMRFKETSLKVLFSDGVRDFRCKAEGFVREENHLEFILEDIKYPFEVHL
HYQVFPEEDVIKKWRVAVNKGEDPVVLERFYSAEYGLPGEGYESINYKGRWGAEFLAHSE
PVNSGKKVYESLYGLTAHTVNPIFMIHKQAGETCGEVYYGALEYSGNFKTVIEAVNSNFL
NILIGISDTDFAWELGAGESFETPAVYAGYSDAGFQKMTHTIHNFCKKYLMPKEFAKKPL
PVLYNSWYSTTFAVHCDEQIELAKRAAKMGVELFVIDDGWFIGRKDDTAGLGDWHVDKEK
FPKGLSELADKVHELGMKFGVWIEPEMVNPKSQLFQLHPEWIYQYPGREVLMGRNQYELD
MANPQVVDYLITIFDQLLTETKIEYIKWDMNRYASEMGSESLDKNQWKELSVRNTKGVYR
LIEELRRRHPEVEFEACASGGGRVDFGAMRYFDEYWPSDNTDALDRLSIQESYSYLYPVK
YMRAWLTDDFGMDRRKIPLQFSMYSAMCGSLGIGIDLNSTSDKKMEEIASYIKVYKEIRE
TVQFGDLYRLCSLKTDKIQAVQYVKDRESVVFIFLDHEQYGDAFHCVKLRGLEENQVYQF
ELEGIQYEKTGAFLMNRGVQVKLYGDYDSKLLRFKKKG

Enzyme Prediction     

No EC number prediction in MGYG000002149_00427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	10	680	4.5e-215	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	9.87e-155	8	696	1	686	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	3.79e-141	260	605	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	2.32e-128	299	597	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	7.11e-50	28	256	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	4.54e-16	620	694	3	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97085.1	0.0	1	698	1	698
QGQ93834.1	4.69e-262	1	693	1	694
AIY84523.1	9.55e-205	3	693	4	684
AMC09013.1	5.28e-201	10	696	11	685
CED94212.1	4.17e-200	4	695	5	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	3.21e-133	5	695	6	725	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	8.32e-130	5	695	6	725	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	3.56e-128	5	665	6	697	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
6PHU_A	6.75e-128	7	696	26	739	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
4FNU_A	7.05e-128	5	695	6	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	4.56e-129	5	695	6	725	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
P27756	1.29e-125	1	697	1	720	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
G1UB44	2.51e-125	8	695	12	729	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	8.27e-119	1	695	1	728	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G4T4R7	1.90e-110	3	679	4	701	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002149_00427.