CAZyme Information: MGYG000002155_00844

Basic Information

• Species: Ruthenibacterium sp900546885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium sp900546885
• CAZyme ID: MGYG000002155_00844
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007		108393.44	9.4464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002155	2379587	MAG	Germany	Europe

• Gene Location: Start: 45228; End: 48251 Strand: +

Full Sequence      

MPEKHAWTRWFWGVMGACALVQLVLAGATAGYAADYNTFWAWALRVAEEGFSGFYAEGYF
ADYPPGGILLLWPLGKLAQLLHISHASAFARCLLAAPGILAGVGLAALCYRLAGPGRARG
FVLGVAAGASPALLYVTGVWKQMDMVYLLFLVACFAALGKRRLFAAALCWGAALALKPQS
LILGPVLAVCVLADAWYSPKRLAALGRAAGAGAAALVPALVCGLPFFGVSGLLPGLFEKY
FSTAQSYPYASLSAANWFSLLGANWAPQTDRLLFFTYAQWGTLHIAVLTAGLCVLAFRAA
KAGRLCPLLLAAAYAAGIFCFAHRMHERYLLMAVFLTLAAAAVRANRQLLAIGCTLGVAA
WLNMLLVVNASTSQDLFLLQGLPAFALRATALAVLLCVCMLLWLAVRLSLWPARDEPLQA
AQLQNFAPMVGLRVLLARRAARRQPMGLPPVPLRWTRRELALLLAGTLALGAVSFARLGN
TAAPQTFVEAQSSLSVTATVDGEAESLMVYQGITQAGGQLRVQDAQGREVLLAQLAPGGC
FSWVRHALSGPGPYTVTVTGAQVFELAFLDAGGQTLPVYSSNGQALFDEQGLVPARPSYE
NSMYFDEIYHARTAYETVHGLPVYETTHPPLGKDIMALGVALFGMTPFGWRCMGTLFGVL
LAPEIYLLARALCRSRRAAALAAVLWGFDFMRFAQSRIGTIDTYAVFFILACSLGMLGFC
RELARTGFTRRAWACLAASGAAFGCAAAVKWTGIFAGAGLAVLYFWALFAKTKALRAQPG
TRAAVRGLWVRALAGGCALFIFLPLAIYLASYLPLGLGTPQYTLADWWDAQQSMYAYHSA
LNATHPFESRWFTWPFDLRPVWYYMGGELPQGMAASIACLGNPLVFWGGTAALAGLAVQQ
ARGNGTRAGRAVLVLWAAQILPWVTVSRCTFLYHYFPGAAFGVLALALLWAEWNARAPRI
ARRAALALAACAGLLFVMFYPALSGLPVPENYARLLLWLPQWQFYSL

Enzyme Prediction     

No EC number prediction in MGYG000002155_00844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	599	813	3e-51	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	6.87e-22	825	950	1	140	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.78e-17	824	1005	498	696	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	3.88e-12	624	928	132	420	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	9.98e-11	598	814	16	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG5542	COG5542	1.87e-06	43	352	76	371	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEJ62095.1	1.52e-148	17	1005	230	1218
QJC51417.1	6.51e-148	2	1006	256	1272
QGG55563.1	4.55e-147	2	1006	256	1286
AIQ44967.1	2.80e-141	7	1004	3	1025
BBI34061.1	4.25e-141	13	1006	268	1243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.15e-27	605	1003	67	516	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	4.12e-26	605	1003	73	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	4.12e-26	605	1003	73	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.76e-19	628	1003	99	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990934	0.001521	0.006092	0.000008	0.000006	0.001473

TMHMM  Annotations     

start	end
10	32
92	114
118	140
147	166
181	198
211	233
275	297
304	326
349	371
384	406
647	669
698	720
746	768
788	810
874	896
909	926
931	953
966	988