CAZyme Information: MGYG000002155_01813

Basic Information

• Species: Ruthenibacterium sp900546885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium sp900546885
• CAZyme ID: MGYG000002155_01813
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002155_25|CGC2	42331.8	7.0098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002155	2379587	MAG	Germany	Europe

• Gene Location: Start: 35370; End: 36467 Strand: +

Full Sequence      

MKKNIKVALVHDWLVTMGGAEKVLWQFHLLFPQAPIYTLVYDSNCGHGMFEDCDVRTTWL
QKIPFATKLYKNMLTLMPSAWEQLDLTEYDLVLSSCSSCCKGIITRPDAVHICYCHTPTR
YVWDFYYQYLKNASALKKLLMPRMIHKMKIWDQLAANRVDYFISNSNFIAQRIKKYYRRD
AKTIYPPVHINEYPLVDEPDDYYLLVSRFVYYKRIDIAIEACNKLQRKLVIIGGGDEEKK
LRAMAGPTITFAGHLDDEEMMQYYVHAKAFLFPGEEDFGITPVEAQSAGCPVLAYGRGGA
LETVLDGRTGLFFTEQTAENLMECIQRFEAQGVEYDRTHIRQHSLSFSEERFRNEVSNCV
NRCNL

Enzyme Prediction     

No EC number prediction in MGYG000002155_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	197	331	1.9e-29	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03804	GT4_WbaZ-like	4.06e-172	6	357	1	356	mannosyltransferase WbaZ and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbaZ in Salmonella enterica has been shown to possess mannosyltransferase activity.
cd03801	GT4_PimA-like	2.05e-32	6	356	1	356	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.58e-31	5	352	1	361	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	3.14e-29	200	337	1	150	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03802	GT4_AviGT4-like	2.87e-28	162	352	133	317	UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUU50752.1	1.13e-152	5	362	1	358
QES75750.1	2.28e-152	5	362	1	358
QEH66969.1	5.85e-152	5	363	1	359
ADZ85468.1	4.76e-151	5	363	1	359
QGH27715.1	4.56e-146	5	355	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	3.87e-15	201	310	24	142	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6CWQ0	2.88e-12	6	306	10	367	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG2 PE=3 SV=1
O94738	1.48e-11	3	311	4	369	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus OX=4840 GN=ALG2 PE=1 SV=1
P43636	2.90e-11	2	304	4	363	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG2 PE=1 SV=2
Q9H553	1.36e-10	17	328	26	376	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
Q96WW6	2.91e-10	2	310	14	370	Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002155_01813.