CAZyme Information: MGYG000002157_00361

Basic Information

• Species: Amulumruptor sp001689515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor sp001689515
• CAZyme ID: MGYG000002157_00361
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		75515.31	9.2908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002157	2499032	MAG	Germany	Europe

• Gene Location: Start: 87049; End: 89103 Strand: -

Full Sequence      

MDRYNQTDKFARVMAFVIVLTAVCITFLPFLGCAPFFTKGEPREAVVALSMLKSGDWILP
ISNGDVIPYKPPFLAWCIAIISLITGGVSEYTSRLPSAIALIVMVVAGYRFWSRRLGIRA
AMIGAVVTFTCFEVYRAGFACRVDMVLTMFIVTGMYSLYTWAMERNMHRLPWVAILLLSC
GTLTKGPVAIVLPLLAVWIAVLLCGYRLWKCTWKMAVVALLALIIPALWYVAAWERGGQE
FLDLAMEENFGRMTGTMSYDSHVNPWWYNLITLLGGLAPYTLLLVIFVVCLLMPQLRHSV
KGGFYRWRTADNARFFMFIAPLVVLIFYCFPSSKRSVYLLPMYPFLAMQIGLLVMWCARK
AGGVVKSFTGTVCVLAIVAAVAFCLLHISAFTSQFTPGLSIRTMQSIGGLMAPAAWWKWG
LVMLSGLVGIIVFVQLFRAGASTATVGMCGVMVTLYMAFGGVYQPAVISYKSDLPMARDL
ERLQPKGEIYSFVVTDMLRFFTADFYVGDRIVPFSYEMSPATGLILIGDDDVWEFHRQWD
GKVALTDTVAQWSKKSCDIGQPVTLYRYVIDDAPRRVARQESLPMDAPAPSSVKPVKPTQ
SKAATPAAAPLPPAKADSVKRTAVANKKDSTAVPAVPVEKKVSQSATESKQAKPDASQAP
VTEIPDSPTAIQSENNNPKTHISQ

Enzyme Prediction     

No EC number prediction in MGYG000002157_00361.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	15	506	4.4e-76	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.10e-38	9	510	2	480	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.28e-12	41	428	33	421	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	9.65e-11	70	230	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	8.76e-05	68	233	61	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG5617	COG5617	0.004	51	361	46	353	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	8.33e-25	20	344	11	329
CAJ73913.1	6.10e-24	19	354	38	357
QAY87139.1	5.03e-23	19	352	17	333
BCX69460.1	5.03e-23	17	352	13	333
SDP25972.1	1.20e-22	20	352	16	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	6.70e-12	41	351	30	304	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
B2VBI7	7.76e-12	41	382	32	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
O67270	1.20e-11	16	348	5	315	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q2NRV9	3.10e-11	41	419	32	408	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1
C5BDQ8	1.25e-10	41	348	32	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002658	0.001558	0.995807	0.000002	0.000002	0.000001

TMHMM  Annotations     

start	end
13	32
66	88
95	112
117	139
146	163
187	209
216	233
270	292
312	331
336	358
370	392
412	434
446	468