CAZyme Information: MGYG000002158_00450

Basic Information

• Species: Desulfovibrio desulfuricans_A
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans_A
• CAZyme ID: MGYG000002158_00450
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000002158_5|CGC1	41022.38	7.9143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002158	2806718	MAG	Germany	Europe

• Gene Location: Start: 43792; End: 44952 Strand: -

Full Sequence      

MGERGNRLNRFLDRWAGIPLTVCTAGLRAAAGTARLNMPAEPQRVGFLCLGAIGDLLLLS
SLITALRRRLPHARFYLLTTSGNAATASLIPGIDESASFSVRKVPAMLDWLRRKKLDMLF
DSSQWPRLGAVLSNLSGAPCTVGFDTPGQCRACGYSHRVPHCADRHEVENFLALGKAVYD
DLEGEPCLALPVEAPADAVRADHMLTELAGACLPRVYLHMWPSGIHARLKEWPSGHWAAL
ARELAGRGFQVCLTGAQGDAARNAAFLVAHADCPAVSLAGDLSLAGLAWMFSRSAGAVSV
NTGTMHLAALAGAPTVGLHGPTNPLRWGPWGRKVQSLLPHSGACAYLNLGFEYPQPPVTC
MENLPVSDVLDALARMGVCGPALAAD

Enzyme Prediction     

No EC number prediction in MGYG000002158_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	109	336	2.5e-41	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.70e-41	47	375	4	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.64e-40	42	375	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.67e-23	111	343	8	233	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.19e-12	38	330	1	299	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	8.33e-11	230	376	189	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SPD36129.1	3.34e-290	1	386	1	386
ATD80622.1	7.69e-290	1	386	23	408
QCC86285.1	8.33e-162	1	378	1	379
QTO40987.1	1.18e-161	1	378	1	379
BAD99045.1	1.03e-104	1	378	1	377

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	9.08e-08	54	334	5	291	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997991	0.002014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	32
45	67