CAZyme Information: MGYG000002159_01176

Basic Information

• Species: UMGS403 sp900540865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS403; UMGS403 sp900540865
• CAZyme ID: MGYG000002159_01176
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230		26956.88	8.031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002159	2536943	MAG	Germany	Europe

• Gene Location: Start: 24628; End: 25320 Strand: +

Full Sequence      

MPEKLIKCLDSWKQYLPDYTIMRWDEQSFDVETNVYTKQAYAHKKYAFVSDVARIKALRK
YGGIYMDTDVEVFRPFDSVLHHRCVLGFEYRNWVATSFMACEKGHSILKLFEKEYDGVSF
ESADGGVNMTTNVERLTALLEEMGLVRDNTYQELPNGIAVYPKEYFSPYDYGNCVMEKTE
NSICAHHFYATWLPWKTKVKKQIKRVITAGIGKKNLVAIRNKIRRQHEEE

Enzyme Prediction     

No EC number prediction in MGYG000002159_01176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	6	81	9.4e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	6.70e-16	2	86	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	8.45e-13	2	110	96	209	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	5.26e-10	1	110	61	183	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	16	69	145	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP42009.1	1.17e-84	2	223	23	243
AIK39696.1	7.37e-73	2	220	22	240
AJI15871.1	7.37e-73	2	220	22	240
AGK52658.1	1.38e-70	2	225	21	243
QOR65486.1	2.24e-69	2	220	22	240

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002159_01176.