CAZyme Information: MGYG000002161_00059

Basic Information

• Species: Methanomassiliicoccus luminyensis
• Lineage: Archaea; Thermoplasmatota; Thermoplasmata; Methanomassiliicoccales; Methanomassiliicoccaceae; Methanomassiliicoccus; Methanomassiliicoccus luminyensis
• CAZyme ID: MGYG000002161_00059
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000002161_3|CGC1	32456.27	7.4184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002161	2620233	Isolate	not provided	not provided

• Gene Location: Start: 19377; End: 20258 Strand: +

Full Sequence      

MRTVSVGVCAYNEENNIGRSLKSILSQELSNASLLEVIVISSASTDRTDEVVGEFVARDS
RVRLLVQPKREGKISAVNLFMSMAKGDILALVNADNNLAPGALGALIALFDDPEVGAAGG
RPVPVNSKDTTIGFAVHMLWAMHHRLSLLHPKIGEFIAFRNAGLQIPQGQSSDEDYIRME
LERRGYRTAYAPDAVVMNKGPETLEDFWEQRVRVNIGEQYLKRRFDYQVPTWNMRFLFPA
LVGLLQDSRGHLGKAAVAMVLELTARVYASVYVTLDKGDKTVWSMVSSTKKLD

Enzyme Prediction     

No EC number prediction in MGYG000002161_00059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	138	1.2e-28	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06439	CESA_like_1	2.17e-44	3	217	30	247	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	1.99e-32	1	213	53	279	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	5.69e-32	5	142	1	135	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	3.35e-26	2	213	2	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	3.78e-26	10	133	5	127	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLH75034.1	2.03e-122	4	293	3	292
AGN25462.1	7.28e-96	1	292	1	293
QHK18300.1	6.42e-91	4	292	11	300
AYQ54288.1	1.10e-90	4	292	6	295
AGI84848.1	1.10e-90	4	292	6	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	5.32e-07	3	96	14	103	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04341	7.39e-14	4	213	51	280	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
P96587	2.40e-13	4	225	51	287	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P72334	2.33e-10	3	213	50	280	N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) OX=103798 GN=nodC PE=3 SV=1
P26024	3.28e-10	4	213	51	280	N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=nodC PE=3 SV=2
Q8YMK0	1.04e-09	4	227	108	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002161_00059.