CAZyme Information: MGYG000002164_00368

Basic Information

• Species: Methanosphaera stadtmanae
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanosphaera; Methanosphaera stadtmanae
• CAZyme ID: MGYG000002164_00368
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	MGYG000002164_1|CGC2	94617.01	5.6938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002164	1767403	Isolate	not provided	not provided

• Gene Location: Start: 433673; End: 436249 Strand: +

Full Sequence      

MDNKNLAIKIAPFIIAILLVLAVFAVRAETINLGGITNSSQKALYQDDSGMPYFTEIDSY
YNYRLTENYLKNGQLGDTVVNGTSWDSLSTSPNGREVNYQPVIVILAALVYKFVNMFGSV
SLTQVAFWLGPIIGSLAVLPAFYIVRRATGNTWGAIVAGVIAGAAPAYFSHTYGGFFDTD
MFNVLLPLMIVVFLTESVYASKPLFKGLYAGIASLFLGLFALSWSGYTYMVLLTFGTLIL
FIPISYIMDKKDGKDLSNKKQWLKNNPATLPLVVFIILSIIILALTVGSSMFESITTVLG
SATSLQSATAGTAYPNVYVSVGELQIPQVIDVANQSGGLFSLLYAVAALFLMGYVLRKKP
VNKDKKDETEEKTETIEDKKPRNRRYTPKTKKAEEVMHHEDVFKPGRYELTSKEKYNNLF
LYVLTLLWILGIAIMLTQGTRFIEQFAVPVALLSGLFVGIMVKYIDLKTENYSYVALIAA
ILVLLAVVSPLYADHLASSQAVGSTNDDMYNTLTWIKANTSQDTVLASWWDFGHLFTAVA
DRQVVFDGGSQNNMRAYWIGNALTSTDEAKSAGILRMLANSGEDASNTLDLYTNNTEKTV
EILNAILPMDRTEANSALTGTYGLSQQEANSVLDLTHPAKVKPVNLILSSDMLSKAAWWS
YFGSWDFKNQNSTHYSYYPSQSNIENINGREFTLGMDNGVIGVSSPTNETNGSTMTFAYV
DQSKLNKSLNMSTLEDKQRMSKELSDGTGNTLLKPHKLIVVENNQLTEKIVNNNSNMSIM
AIHQNDGSYFTVLFDSHLEESLFTKLYLKSGLNVTRFNMTHSEPGISVWDVSEYANTTAN
STTNSSTNGTNVQTNTST

Enzyme Prediction     

No EC number prediction in MGYG000002164_00368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	701	1e-152	0.9393939393939394

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	8.16e-53	27	550	4	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	3.86e-50	10	665	16	673	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC56771.1	0.0	1	858	1	858
AWX32536.1	0.0	1	838	1	839
AEG18866.1	7.11e-207	1	832	1	821
SCG86282.1	1.66e-206	1	832	1	815
ADZ08786.1	1.21e-197	1	832	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTJ_5	7.15e-09	507	611	503	601	Cryo-EMStructure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	7.20e-09	507	611	503	601	Subtomogramaverage of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	7.20e-09	507	611	503	601	Cryo-EMstructure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6C26_A	1.32e-06	507	576	494	562	TheCryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
2LGZ_A	2.06e-06	507	576	49	117	Solutionstructure of STT3P [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2EMT4	5.85e-69	14	836	40	914	Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanococcus voltae OX=2188 GN=aglB PE=1 SV=1
Q58920	4.67e-62	10	831	25	925	Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=aglB PE=3 SV=1
Q8U4D2	3.32e-10	53	549	50	533	Dolichyl-phosphooligosaccharide-protein glycotransferase 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=aglB1 PE=1 SV=1
Q2KJI2	3.94e-08	507	611	503	601	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1
Q5RCE2	3.94e-08	507	611	503	601	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.307909	0.679927	0.010939	0.000435	0.000347	0.000401

TMHMM  Annotations     

start	end
7	26
123	145
152	171
181	200
207	224
229	248
269	291
337	356
416	438
442	464
471	493