CAZyme Information: MGYG000002165_01565

Basic Information

• Species: Zag1 sp900551675
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900551675
• CAZyme ID: MGYG000002165_01565
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000002165_36|CGC1	36062.36	5.4697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002165	1948134	MAG	Denmark	Europe

• Gene Location: Start: 10872; End: 11840 Strand: -

Full Sequence      

MDLKTKLYQMFILGTEGGGYEKALANGLGGIIFFIKDIQSSDEFRKLISDIKSKALIPLF
LSIDQEGGRVERTENIHNGKKYLSAKFAFEKGEDFLRAQTCEIAQELKSYGINLNFAPCI
DVNTNPDNPIIGERAFSNNPDDVIKGEKIVSETYRENGIIPCVKHFPGHGDADADSHLTL
PEIDLPLDEMERTHIKPFAACAKTIEMIMAAHLHCTCFEREAIPTSLSKKAISYLRNKLG
FNGVIISDDMIMAGATGIEPVQACEKGIRAGLNMFIYRNSTPETIEIIESIAQKALQDEE
LRQNIEYSYEKIHDLKKRKNIL

Enzyme Prediction     

No EC number prediction in MGYG000002165_01565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	53	275	1.3e-42	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.06e-59	1	302	1	306	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.48e-50	3	274	2	281	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.87e-42	29	274	27	276	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38577.1	3.63e-182	2	322	3	323
ADU31999.1	8.43e-52	1	316	31	355
QHS23641.1	2.08e-50	1	321	41	369
BBI34846.1	3.41e-50	1	321	10	337
QGU96866.1	5.12e-50	1	321	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.27e-40	1	267	11	292	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3TEV_A	1.03e-36	9	274	20	289	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3BMX_A	2.62e-35	29	316	87	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.09e-34	29	316	61	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.29e-34	29	316	91	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	3.14e-40	28	274	64	332	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q5QUZ5	1.28e-37	12	290	8	289	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
P40406	1.44e-34	29	316	87	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C4LEY6	2.30e-32	28	291	26	290	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q606N2	4.46e-32	29	294	23	289	Beta-hexosaminidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002165_01565.