CAZyme Information: MGYG000002167_00576

Basic Information

• Species: UMGS1572 sp900553045
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1572; UMGS1572 sp900553045
• CAZyme ID: MGYG000002167_00576
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000002167_32|CGC1	46506.41	4.9652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002167	982109	MAG	Denmark	Europe

• Gene Location: Start: 1216; End: 2496 Strand: -

Full Sequence      

MYNFENFYRANVKGIVVDAGHGGSDPGAIGNGLQEKDLTLQAAKYMYQRFKDLGIPVVIT
RDDDSTLTRDERVSKMVNSFGNGSDVLVLSNHINAGGGEGAEIVYPLRTNGNLAQAILDE
IGNAGQKKRKIYQRTLPEDPSKDYYYIQRLTPNTTSLLIEYGFIDNASDVNKLKNNLLDY
VEAVVKAVAEYAGVPYSNPNQPDISEDTGSYVVKSGDTLYGIANKFGVSLNDLKALNKLT
SNLLQIGQVLLIPVAQGEETPTNTTTYVVQRGDSLYSIAQKYGTTVATLRQLNNLTTDLL
QIGQVLKVPQTGTSSSGNVYIVKRGDSLYSIASQYNTTVDAIKLANNLTSNIIQVGQQLI
IPAKDVPSVTPDPDLDENEPITYVVQKGDTLYSIARRFGTTINQIISRNNLPNLILQIGQ
TLIIPQ

Enzyme Prediction     

No EC number prediction in MGYG000002167_00576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	267	309	3.6e-17	0.975
CBM50	211	253	2.2e-16	0.975
CBM50	320	362	4.7e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.44e-43	197	424	319	591	1,4-beta-N-acetylmuramoylhydrolase.
cd02696	MurNAc-LAA	9.32e-39	15	190	2	169	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	6.06e-34	15	190	1	170	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
COG0860	AmiC	6.24e-31	15	191	45	227	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	5.19e-20	242	372	320	455	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	4.60e-69	15	309	2	284
QHS24286.1	1.11e-46	210	422	208	437
ACL69398.1	5.16e-45	179	425	64	303
QIC05530.1	5.38e-45	15	196	85	260
QOY35011.1	2.53e-44	210	425	101	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	6.15e-18	5	173	444	616	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4UZ2_A	9.62e-09	266	309	4	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	1.09e-07	266	309	4	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
5EMI_A	7.47e-07	15	189	7	171	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
7RAG_B	5.27e-06	13	194	17	205	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	1.61e-33	213	424	31	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
O07532	7.83e-32	211	424	94	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q5HRU2	6.51e-28	210	362	28	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	6.51e-28	210	362	28	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
P54421	1.97e-23	173	371	1	202	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002167_00576.