CAZyme Information: MGYG000002168_00270

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_00270
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000002168_5|CGC1	35577.14	7.2435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 8433; End: 9371 Strand: +

Full Sequence      

MAFLHAANRYDNPDTLFVARDGTAEFRNVDDAIEVCRAFMDYHKVIYVKKGVYKEKLTVP
SWLSHIEICGEDRDSTIITYDDHANIKMPGTDRKMGTFRTYTLKIQGNYITLKNITIENN
AARLGQAVALHTEGDHLVFLNCRFLGNQDTVYTGTAGTRLYFKDCFIEGTTDFIFGPSTA
WFEHCMIKSKLNSYITAASTPSGQAFGYVFNHCRLVAAPGVDHVYLGRPWRPYSCVIYMN
CEMGRHICPEGWDNWRNPENEKTARYSEYHSTGEGAKSKERVSWSHQLSKADATSITLER
VFRQDNTWVPAP

Enzyme Prediction     

No EC number prediction in MGYG000002168_00270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	302	6.8e-99	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	3.67e-73	16	293	7	287	pectinesterase
pfam01095	Pectinesterase	2.19e-72	18	297	4	290	Pectinesterase.
PLN02682	PLN02682	5.66e-67	3	293	58	352	pectinesterase family protein
COG4677	PemB	6.58e-62	45	289	114	389	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.23e-60	18	294	15	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	4.01e-182	2	311	15	324
QVJ81978.1	2.99e-160	6	310	19	322
ADE82952.1	2.99e-160	6	310	19	322
AGB28242.1	3.10e-160	6	311	19	324
QNT66521.1	1.76e-153	4	305	17	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	9.66e-39	18	309	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.75e-38	16	296	11	286	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.44e-38	16	296	11	286	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.28e-36	18	284	11	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	7.66e-29	26	310	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.21e-55	18	293	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	7.02e-49	18	310	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8GX86	1.84e-48	4	310	243	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
P41510	2.37e-46	15	291	272	555	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q8VYZ3	5.21e-46	3	309	72	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_00270.