CAZyme Information: MGYG000002168_00997

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_00997
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000002168_19|CGC2	98842.41	6.8038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 20292; End: 22862 Strand: -

Full Sequence      

MTKHIIASLIFGALSMTTGLAASTKPITWEINQGWKFHEARLDNWYPATVPGGVHTDLME
NHIIDDPFFKLNERSVQWIDKEDWIYETHFDMPGNAMDQEHILMTCHGLDTYADVYLNDS
LILKADNMFRIWKADIKGIVKATGNDLRIYFHSPVKIDLPKYEALPFQYPASNDQSENGG
LLDKKIAPFARKAGYHYGWDWGPRLLTCGIWRPITITAWSGVRIDNTYFMQPQVNQQVAH
VCETVTLEATHPMTAVLTLTDEATGYTHARKKVKLKEGDNKVVLDFKVKNPKLWWCNGYG
DPHLYHFKTTVTTDKGRDQKTDKIGLRSLQLVTDKDAEGRAFYFVLNGQKIFMKGANYIP
CDNFLTRVNDSIYRKTIDDAVAVHMNMLRVWGGGIYEDDRFYDLCDEKGILIWQDFMFAC
GLFPATGHYLENIRLEAIDNVTRLRNHPCIALWCGNNECQDGWYNWGWKKKFEKQNQAYA
DTIWSQFKRQYYEVLPAVVKAYDPEISYWPSSPFADYGGGSKPTMGDYHYWEVWHGRKPI
SEYNKVRARFFSEYGMQSFPEFESVKRFAPDSRDWDIHSEVMMWHQRGGAHANGLIETYL
ESEYKKPNHFQDLLYVGQLMQGDAMKTAVEAHRRDKGYCWGTLIWQINDCWPVASWSTRD
YYGRWKAAHYFMRQAMDDILVSPIEKEDQLHVYLVSDRLKAVKGTLTIEVEKMDGTIVNR
ISKVANAEANSSHDALNIPIHDLLKGSPRKDVFLHVMFKADKTYENNYCLDVPKNMNFPK
ATIQSTVKDIQGGVEITLTADRFARGVFMSIPGHDYFFEDNYIDLLPGRPKTIHVDTPMT
SAQVRNQLKIVSLSDI

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	763	5.2e-105	0.7207446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.29e-110	32	837	16	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.19e-21	780	855	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.19e-15	688	775	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	6.63e-10	222	327	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	6.76e-07	76	458	55	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60279.1	0.0	7	855	11	863
QUT74423.1	0.0	2	855	11	862
QUT88714.1	0.0	7	855	11	863
QDO68488.1	0.0	7	855	11	863
QBJ17295.1	0.0	31	855	15	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.10e-216	31	838	11	819	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.24e-216	31	838	13	821	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.31e-216	31	838	13	821	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	6.11e-216	31	838	11	819	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	2.66e-214	31	838	11	819	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	5.27e-132	31	736	9	733	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	7.39e-132	31	736	9	733	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	1.45e-131	31	736	9	733	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.62e-131	31	736	9	733	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q0CCA0	1.26e-127	34	714	12	702	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999043	0.000182	0.000187	0.000168	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_00997.