CAZyme Information: MGYG000002168_01070

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_01070
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000002168_21|CGC2	56516.88	9.5049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 27968; End: 29446 Strand: +

Full Sequence      

MPVCLAPAAFALWHKDKQFPWQRQGKLDTMIRSCMPKGANLQKIYRIACYLCAHQSCIKV
RTIIMSMKQSHILWIVILIAFLPMILLRDLTPDNELRYVHIAESALRSGNLFAFTLNGEP
YADKPPFYIWLIILCRLISGKYLVWELSLLSFIPAVIITHTMEKWMGTGLTDKERITARL
MLMSSVYFIAASIVARMDMLMSMFIILALYTFWKRYQHQGTGKDRWLFPIYLFLAVFTKG
PLGLLIPLVSIVGFLVYKHQGKQFLHYWDLRTWIVLIIGCAIWFTASYQEGGSAYMYDLF
LHQTFGRAFHAFHHEQPFYFYLISIWYELAPWSLLVVAIIVECVRRHLQLSDLQKFMLCS
VVLSFLLLSVISAKLPIYLLPTFPFAVFLTVSLMSRFADRKWVRICIGIPAALLCLVFPA
IALGYTLLSFPILGNGLIWMAAACFSFSGARTLYQLRHDHSFTDPLRTLAVGMFLALFFI
GCAMPALNPLLS

Enzyme Prediction     

No EC number prediction in MGYG000002168_01070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	69	481	1e-63	0.7759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.05e-25	65	445	2	391	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.10e-10	67	486	1	430	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	3.38e-113	69	488	2	423
QTO25703.1	1.35e-112	69	488	2	423
QLK84536.1	1.35e-112	69	488	2	423
QUU03965.1	2.13e-111	69	488	2	423
QRP88934.1	2.38e-110	69	488	2	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	9.59e-16	67	401	2	328	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	7.09e-12	87	421	26	361	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	3.88e-11	87	389	24	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
C5BDQ8	1.19e-10	88	400	25	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4ETL9	1.97e-09	88	381	29	323	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
70	87
127	149
185	207
227	257
264	286
318	340
361	383
403	425
432	454
469	491