CAZyme Information: MGYG000002168_01167

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_01167
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000002168_24|CGC1	55552.24	6.9149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 3820; End: 5277 Strand: -

Full Sequence      

MSICKVVFIFGLVAMSYSCSCLRQGEPKPTKGQRAMIERKYGMFLHFGMNTYLNEEWSDG
KAPASTYNPPIDIAEKAAGWVRNAKRAGMRSIVLTTKHHDGFCLWDSKYTDYDIANPAIK
NKVDIVKAVSDACKKEGIAFSVYYSLWDRHEPIYMDSDKHAYIQYMKNQLQELMTNYGEV
HELWFDGAWDRKAGDWYLPEVYEFVKKMQPNCQISTNWTIGKHPVDMHKGDSIIYFPSDF
RLWDPYLPTKNDPKIYTHNGKKYYLPFESTQTISVIGSWFNHPEDTTVRDVEDLEEIFYV
STANDNCLLLNIPPATNGEQNPKAIENINQLAKLLGIENGKKFPKKLKKPQSKTTNATAV
ASSVYKNDTLHNGAMYAVDSDVSTAWVAGDSLAWINVELGQKETFSRLFIIAGENSIRKF
TVEVEKNKLWMPVYESDILPETNLNSFMGYGILDFNLPESVTVDHFRINILQSNNRPSIY
TIRLK

Enzyme Prediction     

No EC number prediction in MGYG000002168_01167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	38	335	1.4e-66	0.838150289017341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	2.29e-49	40	340	26	332	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.66e-46	38	340	25	334	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	3.24e-40	27	340	9	317	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.40e-07	358	482	1	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam14871	GHL6	0.003	81	150	6	74	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ30775.1	2.08e-264	2	485	6	490
QCQ35194.1	8.46e-264	2	485	6	490
QTO26591.1	1.20e-263	2	485	6	490
QRO24262.1	1.09e-259	7	485	9	490
ATP55793.1	6.17e-130	5	482	3	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	3.34e-53	27	322	37	339	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	1.13e-44	29	343	32	367	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	1.53e-40	29	318	10	302	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
6ORG_A	4.85e-37	27	332	9	316	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	4.44e-36	27	332	9	316	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	8.77e-42	9	331	14	339	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.27e-39	27	447	38	449	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	1.52e-14	38	319	36	326	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q9VTJ4	2.80e-14	38	210	52	252	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P10901	1.81e-12	40	428	41	433	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000334	0.998936	0.000268	0.000143	0.000141	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_01167.