CAZyme Information: MGYG000002168_02642

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_02642
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		50951.08	8.3774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 8828; End: 10177 Strand: +

Full Sequence      

MKISVVGSILAACLMTGPAARAQKTVSLEDSASYEKRMEWFGKAKLGIFIHWGIYAVRGV
SESWSFYNEYLPYDEYMSQLKGFTAKKYDPKAWASLIKESGAQYTVMTTKHHDGVALWDT
KAGNLSMKKCTPAKRDLIAPFVDAVRSEGLKVGLYYSLLDWSNENYPNKTKTQHRYTNDP
QRWDKFVKFNLAQLSELSNTFNPDLFWFDGDWEQTAEAWHAPEIVKMLRAKNPNVILNSR
IQGYGDYATPEQGIPVVRPKSKYWELCQTINDSWGYQPTDTNFKSPYQVLRTFCDCLGNG
GNMLLDIGPRADGTIPQPEVDVLKELGRWTKKHQEAIYDTRAGIPSYCFQGYTTLNKAGD
ILYLYIPYRPHGVVEVKGLLNKVNRVWVVGNGTMLNYKLYNKAYWSSTPGNLYIDVPDSV
LDPQITVLAVLLDGPVKISNGEWQVITAN

Enzyme Prediction     

No EC number prediction in MGYG000002168_02642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	19	339	2e-102	0.9335260115606936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	4.40e-126	29	379	11	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	4.73e-112	38	335	19	333	Alpha-L-fucosidase.
COG3669	AfuC	5.06e-38	51	342	1	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	8.83e-04	89	209	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13662.1	2.01e-249	27	449	23	447
QUT85171.1	8.78e-249	14	445	14	445
AND21567.1	8.78e-249	14	445	14	445
QEW35856.1	1.77e-248	14	445	14	445
ABR41654.1	3.57e-248	14	445	14	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	2.15e-87	35	433	28	444	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
6HZY_A	3.36e-52	14	414	16	455	Crystalstructure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482],6HZY_B Crystal structure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482]
4WSK_A	1.57e-51	14	414	17	453	Crystalstructure of a bacterial fucosidase with phenyl((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)methanone [Bacteroides thetaiotaomicron VPI-5482],4WSK_B Crystal structure of a bacterial fucosidase with phenyl((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)methanone [Bacteroides thetaiotaomicron VPI-5482],4WSK_C Crystal structure of a bacterial fucosidase with phenyl((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)methanone [Bacteroides thetaiotaomicron VPI-5482],4WSK_D Crystal structure of a bacterial fucosidase with phenyl((1R,2R,3R,4R,5R,6R)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)methanone [Bacteroides thetaiotaomicron VPI-5482]
2WVS_A	2.46e-51	22	414	2	434	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVT_A	2.46e-51	22	414	2	434	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99LJ1	2.44e-45	40	377	38	397	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
P10901	4.02e-45	40	366	36	390	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
C3YWU0	1.66e-44	30	341	23	356	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q99KR8	4.00e-44	40	340	43	364	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P48300	5.98e-44	39	417	51	444	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009048	0.898758	0.090386	0.000802	0.000480	0.000473

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_02642.