CAZyme Information: MGYG000002168_02680

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_02680
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40785.67	7.9618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 7313; End: 8359 Strand: -

Full Sequence      

MKICNYVILMVLAWVMPSLMSAQKLILPIPSDKPSAAQMKQIQRKYGMFLHFGMNTFHDQ
EWTDGTKPASSYRPTTIDADQWIKGAKDSGMKYVILVTKHHDGFCLWDSKYTDYDVASSG
NKTNVVEAVAKACKKYHIGLGLYYSLWDRHQNADVDNENLDDAYNEYMIGQLKELLAITK
KYTHVVEFWFDGGWVKRNYRWPVMDIYQTIKSVEKDCQVGINWNLYDPSHPSDNVVPEKQ
KKWMPIRYFPTDFRLGDPYLPADNDPKVFTYDAKHYYMPWESTLCISERWFYNTKDAKYK
SLDELESIYKRATKNDNILIINCPPNREGKLRSKDLELLGQLRERLNL

Enzyme Prediction     

No EC number prediction in MGYG000002168_02680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	43	344	3.4e-66	0.8323699421965318

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	1.21e-43	45	342	26	324	Alpha-L-fucosidase.
COG3669	AfuC	2.73e-40	33	347	10	313	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	5.98e-37	43	342	25	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24265.1	2.70e-190	22	348	22	349
QCQ35196.1	3.88e-186	22	348	20	347
QTO26593.1	3.88e-186	22	348	20	347
QCQ30777.1	3.88e-186	22	348	20	347
QOD59462.1	1.02e-182	21	346	19	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	6.16e-45	34	341	32	347	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6ORG_A	1.60e-41	34	339	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
3UES_A	6.57e-41	33	347	18	348	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
6OR4_A	1.58e-40	34	339	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	1.61e-40	34	339	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	4.03e-43	26	347	34	341	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	4.59e-40	26	344	36	339	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	3.06e-13	45	331	38	327	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	5.40e-12	45	223	41	257	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
C3YWU0	4.02e-11	81	331	101	330	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000192	0.999220	0.000160	0.000138	0.000134	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_02680.