CAZyme Information: MGYG000002170_00958

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q
• CAZyme ID: MGYG000002170_00958
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	MGYG000002170_42|CGC1	49843.37	6.0116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002170	2623587	MAG	Denmark	Europe

• Gene Location: Start: 4678; End: 6018 Strand: +

Full Sequence      

MNPNHQTFPPVSGAVNILSITAQKPHSTGSGVYLTEIVQALHRQGCRQAVLAGICREDSV
SFPEDVVFYPVYYQSDQIPFPICGMSDEMPYESTRYQDLTPTMTAQFLNSFGKVLKQALN
EFRPDLIICHHLYLLTALAREITPAESTQNTNKPRIVGICHGSDLRQFKKNPMNRDYIRS
QIRCLDTIWCLHREQGQEIIRLFGCSPEKVKILGTGYNSLIFKKISPLLAEHKIANSEQS
PSPGRIRLIFAGKLSEKKGVKSLLRSLRLLPPDLAERLSLTLAGGWGNLQEFQEIKQLAD
PEQGCPCAVEFPGRLSQTELAQQMNQSDLFILPSFYEGLPLVLIEALACGLRPICTDLPG
IRPWMDENVPGHGIIFVAPPDMEHEDEPVASSLPAFEAKLAEAIIQAADCMSCMSSPVSR
QERLDNSLQQLSWDGLCKRLLEDIER

Enzyme Prediction     

No EC number prediction in MGYG000002170_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	243	372	5e-23	0.775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.95e-29	25	445	11	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03798	GT4_WlbH-like	9.92e-26	17	442	1	371	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
COG0438	RfaB	5.17e-24	25	446	12	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	9.89e-22	106	406	65	325	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03811	GT4_GT28_WabH-like	1.33e-21	107	411	67	335	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK76687.1	1.00e-165	15	444	1	446
CBL36522.1	2.85e-165	15	444	1	446
QRT49164.1	2.29e-127	15	446	1	403
QEK18101.1	6.31e-113	15	442	1	395
ASN93578.1	1.05e-110	15	406	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	1.60e-10	179	442	148	394	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R2E2	8.31e-10	179	442	134	380	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1
Q46638	1.58e-09	122	371	118	350	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2
D2Q1C4	1.66e-09	182	374	174	370	D-inositol 3-phosphate glycosyltransferase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=mshA PE=3 SV=1
D7C367	2.39e-09	194	372	211	394	D-inositol 3-phosphate glycosyltransferase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=mshA PE=3 SV=1
B8HCF8	2.90e-09	195	361	180	340	D-inositol 3-phosphate glycosyltransferase OS=Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) OX=452863 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002170_00958.